UniProt ID | CNRP1_RAT | |
---|---|---|
UniProt AC | Q5M7A7 | |
Protein Name | CB1 cannabinoid receptor-interacting protein 1 | |
Gene Name | Cnrip1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 164 | |
Subcellular Localization | ||
Protein Description | Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.. | |
Protein Sequence | MGDLPGIVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKCKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
26 | Acetylation | NDGPVFFKVDGQRFG CCCCEEEEECCEEEC | 28.14 | 22902405 | |
39 | Acetylation | FGQNRTIKLLTGSSY ECCCCEEEEECCCCE | 36.51 | 22902405 | |
39 | Ubiquitination | FGQNRTIKLLTGSSY ECCCCEEEEECCCCE | 36.51 | - | |
47 | Acetylation | LLTGSSYKVEVKIKP EECCCCEEEEEEECC | 33.59 | 22902405 | |
85 | Phosphorylation | PDGERVVYTGIYDTE CCCCEEEEEEEEECC | 9.08 | - | |
89 | Phosphorylation | RVVYTGIYDTEGVAP EEEEEEEEECCCCCC | 20.39 | - | |
91 | Phosphorylation | VYTGIYDTEGVAPTK EEEEEEECCCCCCCC | 20.05 | - | |
98 | Ubiquitination | TEGVAPTKSGERQPI CCCCCCCCCCCCCCE | 56.24 | - | |
130 | Acetylation | VKFYNYHKRDHCQWG EEEECCCCCCCCCCC | 49.51 | 22902405 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNRP1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNRP1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNRP1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CNRP1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...