UniProt ID | CNRP1_MOUSE | |
---|---|---|
UniProt AC | Q5M8N0 | |
Protein Name | CB1 cannabinoid receptor-interacting protein 1 | |
Gene Name | Cnrip1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 164 | |
Subcellular Localization | ||
Protein Description | Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.. | |
Protein Sequence | MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
26 | Ubiquitination | NDGPVFFKVDGQRFG CCCCEEEEECCEEEC | 28.14 | 22790023 | |
42 | Phosphorylation | NRTIKLLTGSSYKVE CCEEEEECCCCEEEE | 45.51 | 22871156 | |
98 | Ubiquitination | TEGVAPTKSGERQPI CCCCCCCCCCCCCCE | 56.24 | 22790023 | |
134 | S-palmitoylation | NYHKRDHCQWGSPFS CCCCCCCCCCCCCEE | 4.22 | 28680068 | |
138 | Phosphorylation | RDHCQWGSPFSVIEY CCCCCCCCCEEEEEE | 21.58 | - | |
147 | S-palmitoylation | FSVIEYECKPNETRS EEEEEEEECCCCCEE | 9.69 | 28680068 | |
154 | Phosphorylation | CKPNETRSLMWVNKE ECCCCCEEEEEECCC | 29.96 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNRP1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNRP1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNRP1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CNRP1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...