UniProt ID | CNMD_HUMAN | |
---|---|---|
UniProt AC | O75829 | |
Protein Name | Leukocyte cell-derived chemotaxin 1 {ECO:0000305} | |
Gene Name | CNMD {ECO:0000312|HGNC:HGNC:17005} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 334 | |
Subcellular Localization |
Chondromodulin-1: Secreted, extracellular space, extracellular matrix. Accumulated in the inter-territorial matrix of cartilage. Chondrosurfactant protein: Endomembrane system Single-pass membrane protein . |
|
Protein Description | Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization.. | |
Protein Sequence | MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIGAFYFWKGSDSHIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
100 | Phosphorylation | DAGNNLETFKMGSGA CCCCCCCEEECCCCH | 24275569 | ||
105 | Phosphorylation | LETFKMGSGAEEAIA CCEEECCCCHHCEEE | 24275569 | ||
121 | Phosphorylation | NDFQNGITGIRFAGG CCCCCCCCEEEECCC | 24719451 | ||
180 | Sumoylation | VAVDQPVKDNSFLSS EEECCCCCCCCCHHH | - | ||
226 | Acetylation | KIVPTTTKRPHSGPR HHCCCCCCCCCCCCC | 19811469 | ||
243 | N-linked_Glycosylation | PGAGRLNNETRPSVQ CCCCCCCCCCCCCHH | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNMD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNMD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNMD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CNMD_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...