CNIH4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CNIH4_HUMAN
• UniProt AC: Q9P003
• Protein Name: Protein cornichon homolog 4
• Gene Name: CNIH4
• Organism: Homo sapiens (Human).
• Sequence Length: 139
• Subcellular Localization: Membrane ; Multi-pass membrane protein . Endoplasmic reticulum . Endoplasmic reticulum-Golgi intermediate compartment .
• Protein Description: Involved in G protein-coupled receptors (GPCRs) trafficking from the endoplasmic reticulum to the cell surface; it promotes the exit of GPCRs from the early secretory pathway, likely through interaction with the COPII machinery. [PubMed: 24405750]
• Protein Sequence: MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
85	Phosphorylation	ATWNIYRYIMVPSGN HHHHHHHHHEECCCC	4.03	24719451
87	Sulfoxidation	WNIYRYIMVPSGNMG HHHHHHHEECCCCCC	2.41	30846556
90	Phosphorylation	YRYIMVPSGNMGVFD HHHHEECCCCCCCCC	31.24	24719451
93	Sulfoxidation	IMVPSGNMGVFDPTE HEECCCCCCCCCHHH	5.74	30846556

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CNIH4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CNIH4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CNIH4_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CNIH4_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.