dbPTM

CNIH3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CNIH3_HUMAN
UniProt AC	Q8TBE1
Protein Name	Protein cornichon homolog 3
Gene Name	CNIH3
Organism	Homo sapiens (Human).
Sequence Length	160
Subcellular Localization	Cell junction, synapse, postsynaptic cell membrane Multi-pass membrane protein. Also localizes to the cell membrane of extrasynaptic sites (dendritic shafts, spines of pyramidal cells)..
Protein Description	Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by regulating their rates of activation, deactivation and desensitization..
Protein Sequence	MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	Phosphorylation	RKLVLPEYSIHSLFC HHHHCCCCCHHHHHH	15.81	24248375
73	Phosphorylation	KLVLPEYSIHSLFCI HHHCCCCCHHHHHHH	16.50	24248375
76	Phosphorylation	LPEYSIHSLFCIMFL CCCCCHHHHHHHHHH	22.82	24248375
90	Phosphorylation	LCAQEWLTLGLNVPL HHHHHHHHHCCCHHH	21.61	24248375
100	Phosphorylation	LNVPLLFYHFWRYFH CCHHHHHHHHHHHHC	8.97	24248375

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CNIH3_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CNIH3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CNIH3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CNIH3_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CNIH3_HUMAN

Related Literatures of Post-Translational Modification