UniProt ID | CNBP1_MOUSE | |
---|---|---|
UniProt AC | Q9JJN6 | |
Protein Name | Beta-catenin-interacting protein 1 | |
Gene Name | Ctnnbip1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 81 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.. | |
Protein Sequence | MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVSSQLSQLPQHSIDQGAEDVVMAFSRSETEDRRQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Acetylation | NREGAPGKSPEEMYI CCCCCCCCCHHHHHH | 62.87 | 15628213 | |
10 | Phosphorylation | REGAPGKSPEEMYIQ CCCCCCCCHHHHHHH | 43.38 | 22817900 | |
19 | Ubiquitination | EEMYIQQKVRVLLML HHHHHHHHHHHHHHH | 18.68 | 27667366 | |
19 | Acetylation | EEMYIQQKVRVLLML HHHHHHHHHHHHHHH | 18.68 | 22826441 | |
31 | Phosphorylation | LMLRKMGSNLTASEE HHHHHHCCCCCCCHH | 25.76 | 22817900 | |
43 | Phosphorylation | SEEEFLRTYAGVVSS CHHHHHHHHHHHHHH | 21.63 | 26643407 | |
44 | Phosphorylation | EEEFLRTYAGVVSSQ HHHHHHHHHHHHHHH | 8.57 | 26643407 | |
49 | Phosphorylation | RTYAGVVSSQLSQLP HHHHHHHHHHHHCCC | 15.23 | 26643407 | |
50 | Phosphorylation | TYAGVVSSQLSQLPQ HHHHHHHHHHHCCCC | 24.43 | 26643407 | |
53 | Phosphorylation | GVVSSQLSQLPQHSI HHHHHHHHCCCCCCC | 23.26 | 26643407 | |
59 | Phosphorylation | LSQLPQHSIDQGAED HHCCCCCCCCCCHHH | 23.71 | 27180971 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNBP1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNBP1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNBP1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CTNB1_MOUSE | Ctnnb1 | physical | 10898789 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...