UniProt ID | CNBL5_ARATH | |
---|---|---|
UniProt AC | Q7FZF1 | |
Protein Name | Calcineurin B-like protein 5 | |
Gene Name | CBL5 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 203 | |
Subcellular Localization | Cytoplasm . Nucleus . Targeted to the cell membrane when interacting with CIPK24. | |
Protein Description | Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner. May function as a positive regulator of salt or drought responses.. | |
Protein Sequence | MGCVCSKQLEGRRQEDISLLASQTFFSEAEVEVLHGLFIKLTSCLSNDNLLTKEKFQFILIKNTKKRSLSAERIFGLFDMRNDGAIDFGEFVHTLNIFHPNSSPRDKAIFAFRLYDTRETGFIEPEEVKEMIIDVLEESELMLSESIIDSIVSKTFEEADWKKDGIIDLEEWENFVATYPLTLKNMTIPFLKDIPRIFPTFLR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGCVCSKQL ------CCCCCCCCC | 16.74 | 18502848 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNBL5_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNBL5_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNBL5_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CIPKA_ARATH | SIP1 | physical | 11402167 | |
CIPKO_ARATH | SOS2 | physical | 19832944 | |
CIPKO_ARATH | SOS2 | physical | 22253446 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...