CN119_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CN119_HUMAN
• UniProt AC: Q9NWQ9
• Protein Name: Uncharacterized protein C14orf119
• Gene Name: C14orf119
• Organism: Homo sapiens (Human).
• Sequence Length: 140
• Subcellular Localization: Mitochondrion .
• Protein Sequence: MPLESSSSMPLSFPSLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLEDLVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEFSEPDFVAKFYQAVAATAGKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MPLESSSSMPLS ---CCCCCCCCCCCC	43.11	24043423
6	Phosphorylation	--MPLESSSSMPLSF --CCCCCCCCCCCCC	19.63	24043423
7	Phosphorylation	-MPLESSSSMPLSFP -CCCCCCCCCCCCCC	39.68	24043423
8	Phosphorylation	MPLESSSSMPLSFPS CCCCCCCCCCCCCCH	26.77	24043423
12	Phosphorylation	SSSSMPLSFPSLLPS CCCCCCCCCCHHCCC	29.28	24043423
15	Phosphorylation	SMPLSFPSLLPSVPH CCCCCCCHHCCCCCC	40.29	24043423
19	Phosphorylation	SFPSLLPSVPHNTNP CCCHHCCCCCCCCCC	48.53	24043423
24	Phosphorylation	LPSVPHNTNPSPPLM CCCCCCCCCCCCCHH	45.53	24043423
27	Phosphorylation	VPHNTNPSPPLMSYI CCCCCCCCCCHHHHH	41.02	24043423
32	Phosphorylation	NPSPPLMSYITSQEM CCCCCHHHHHCHHHH	22.52	24043423
33	Phosphorylation	PSPPLMSYITSQEMK CCCCHHHHHCHHHHH	8.34	24043423
35	Phosphorylation	PPLMSYITSQEMKCI CCHHHHHCHHHHHHH	19.00	24043423
36	Phosphorylation	PLMSYITSQEMKCIL CHHHHHCHHHHHHHH	18.00	24043423
64	Ubiquitination	FLEDLVAKAVPEKLQ HHHHHHHHHCHHHHH	42.30	22817900
69	Ubiquitination	VAKAVPEKLQPLLDS HHHHCHHHHHHHHHH	46.48	22817900
128	Ubiquitination	SEPDFVAKFYQAVAA CCHHHHHHHHHHHHH	39.02	-
130	Phosphorylation	PDFVAKFYQAVAATA HHHHHHHHHHHHHHC	8.54	-
139	Ubiquitination	AVAATAGKD------ HHHHHCCCC------	58.77	21906983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CN119_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CN119_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CN119_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CN119_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.