CML37_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CML37_ARATH
• UniProt AC: Q9FIH9
• Protein Name: Calcium-binding protein CML37
• Gene Name: CML37
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 185
• Protein Description: Potential calcium sensor that binds calcium in vitro..
• Protein Sequence: MTLAKNQKSSLSRLYKKVSSKRSESSRNLEDESRTSSNSSGSSSLNVNELRTVFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVKTSDVDGDGFIDFEEFLKLMEGEDGSDEERRKELKEAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKVMIRGFDQNDDGVLSFDEFVLMMR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	VSSKRSESSRNLEDE HHHHCCCCCCCCCCC	35.53	19880383
26	Phosphorylation	SSKRSESSRNLEDES HHHCCCCCCCCCCCC	22.57	19880383
149	Phosphorylation	ASLRRTLSRLGESCT HHHHHHHHHHCCCCC	25.50	30300945

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CML37_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CML37_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CML37_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of CML37_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.