CLPP5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CLPP5_ARATH
• UniProt AC: Q9S834
• Protein Name: ATP-dependent Clp protease proteolytic subunit 5, chloroplastic {ECO:0000303|PubMed:11299370}
• Gene Name: CLPP5 {ECO:0000303|PubMed:11299370}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 298
• Subcellular Localization: Plastid, chloroplast stroma .
• Protein Description: Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity)..
• Protein Sequence: MAHACVSTSASSLRFTAGFVSASPNGSSFDSPKLSLPFEPLRSRKTNKLVSDRKNWKNSTPKAVYSGNLWTPEIPSPQGVWSIRDDLQVPSSPYFPAYAQGQGPPPMVQERFQSIISQLFQYRIIRCGGAVDDDMANIIVAQLLYLDAVDPTKDIVMYVNSPGGSVTAGMAIFDTMRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQTDIDIQANEMLHHKANLNGYLAYHTGQSLEKINQDTDRDFFMSAKEAKEYGLIDGVIMNPLKALQPLAAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Phosphorylation	RFTAGFVSASPNGSS EEEEEEEEECCCCCC	22.29	19880383
27	Phosphorylation	VSASPNGSSFDSPKL EEECCCCCCCCCCCC	34.18	19880383
101	Acetylation	YFPAYAQGQGPPPMV CCCHHHCCCCCCHHH	26.66	22223895

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CLPP5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CLPP5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CLPP5_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of CLPP5_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.