| UniProt ID | CLIP3_MOUSE | |
|---|---|---|
| UniProt AC | B9EHT4 | |
| Protein Name | CAP-Gly domain-containing linker protein 3 | |
| Gene Name | Clip3 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 547 | |
| Subcellular Localization |
Cell membrane Lipid-anchor. Cytoplasm. Golgi apparatus, Golgi stack. Localized to Golgi stacks as well as on tubulovesicular elements juxtaposed to Golgi cisternae.. |
|
| Protein Description | Functions as a cytoplasmic linker protein. Involved in TGN-endosome dynamics. May modulate the cellular compartmentalization of AKT kinase family and promote its cell membrane localization, thereby playing a role in glucose transport in adipocytes (By similarity).. | |
| Protein Sequence | MTKTDPAPMAPPPRGEEEEEEEEDEPVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFTFFDPNDPACQEILFDPKTTIPELFAIVRQWVPQVQHKIDVIGNEILRRGCHVNDRDGLTDMTLLHYACKAGAHGVGDPAAAVRLSQQLLALGADVTLRSRWTNMNALHYAAYFDVPDLVRVLLKGARPRVVNSTCSDFNHGSALHIAASNLCLGAAKCLLEHGANPALRNRKGQVPAEVVPDPMDMSLDKAEAALVAKELRTLLEEAVPLSCTLPKVTLPNYDNVPGNLMLSALGLRLGDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFASVSKVSKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKSPSSPSLGSLQQREGAKAEVGDQVLVAGQKQGIVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCAPRHGVFAPASRIQRIGGSTDPPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MTKTDPAPMAP ----CCCCCCCCCCC | 37.74 | 25159016 | |
| 32 | Phosphorylation | EPVPEAPSPTQERRQ CCCCCCCCCCCHHCC | 47.85 | 25521595 | |
| 34 | Phosphorylation | VPEAPSPTQERRQKP CCCCCCCCCHHCCCC | 47.61 | 25521595 | |
| 182 | Ubiquitination | DLVRVLLKGARPRVV HHHHHHHCCCCCEEE | 46.49 | 27667366 | |
| 276 | Phosphorylation | SCTLPKVTLPNYDNV CCCCCCEECCCCCCC | 42.49 | 29514104 | |
| 280 | Phosphorylation | PKVTLPNYDNVPGNL CCEECCCCCCCCCCH | 13.62 | 21454597 | |
| 306 | Ubiquitination | RVLLDGQKTGTLRFC EEEECCCCCEEEEEC | 55.22 | 22790023 | |
| 356 | Phosphorylation | PKQGLFASVSKVSKA CCCCCEEEHHHHHCC | 21.42 | 29514104 | |
| 358 | Phosphorylation | QGLFASVSKVSKAVD CCCEEEHHHHHCCCC | 25.50 | 29514104 | |
| 369 | Phosphorylation | KAVDAPPSSVTSTPR CCCCCCCCCCCCCCC | 36.06 | 19060867 | |
| 370 | Phosphorylation | AVDAPPSSVTSTPRT CCCCCCCCCCCCCCC | 34.88 | 22817900 | |
| 372 | Phosphorylation | DAPPSSVTSTPRTPR CCCCCCCCCCCCCCC | 28.91 | 19060867 | |
| 373 | Phosphorylation | APPSSVTSTPRTPRM CCCCCCCCCCCCCCC | 33.97 | 19060867 | |
| 374 | Phosphorylation | PPSSVTSTPRTPRMD CCCCCCCCCCCCCCC | 13.87 | 22817900 | |
| 377 | Phosphorylation | SVTSTPRTPRMDFSR CCCCCCCCCCCCHHH | 19.22 | 19060867 | |
| 386 | Phosphorylation | RMDFSRVTGKGRREH CCCHHHCCCCCCCCC | 31.87 | 29899451 | |
| 399 | Phosphorylation | EHKGKKKSPSSPSLG CCCCCCCCCCCCCHH | 38.60 | 25521595 | |
| 401 | Phosphorylation | KGKKKSPSSPSLGSL CCCCCCCCCCCHHHH | 63.07 | 25521595 | |
| 402 | Phosphorylation | GKKKSPSSPSLGSLQ CCCCCCCCCCHHHHH | 23.15 | 25521595 | |
| 404 | Phosphorylation | KKSPSSPSLGSLQQR CCCCCCCCHHHHHHH | 47.51 | 25521595 | |
| 407 | Phosphorylation | PSSPSLGSLQQREGA CCCCCHHHHHHHCCC | 28.44 | 29899451 | |
| 428 | Ubiquitination | QVLVAGQKQGIVRFY EEEECCCCCEEEEEE | 49.96 | 22790023 | |
| 456 | Ubiquitination | ELDQPTGKHDGSVFG EECCCCCCCCCCEEE | 40.79 | 22790023 | |
| 480 | Phosphorylation | HGVFAPASRIQRIGG CCCEECHHHCEECCC | 28.93 | - | |
| 488 | Phosphorylation | RIQRIGGSTDPPGDS HCEECCCCCCCCCCC | 25.15 | 25338131 | |
| 499 | Ubiquitination | PGDSVGAKKVHQVTM CCCCCCCEEEEEEEE | 49.77 | 27667366 | |
| 510 | Ubiquitination | QVTMTQPKRTFTTVR EEEECCCCCEEEECC | 55.01 | 27667366 | |
| 520 | Ubiquitination | FTTVRTPKDIASENS EEECCCHHHHCCCCH | 62.24 | 22790023 | |
| 534 | S-palmitoylation | SISRLLFCCWFPWML HHHHHHHHHHHHHHH | 1.70 | - | |
| 535 | S-palmitoylation | ISRLLFCCWFPWMLR HHHHHHHHHHHHHHH | 3.08 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLIP3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLIP3_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLIP3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AKT1_MOUSE | Akt1 | physical | 19139280 | |
| AKT2_MOUSE | Akt2 | physical | 19139280 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...