UniProt ID | CLIC5_RAT | |
---|---|---|
UniProt AC | Q9EPT8 | |
Protein Name | Chloride intracellular channel protein 5 | |
Gene Name | Clic5 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 251 | |
Subcellular Localization |
Golgi apparatus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Membrane Single-pass membrane protein. Cytoplasm. Colocalized with AKAP9 at the Golgi apparatus as well as, to a lesser extent, the centrosome. Exists both as solub |
|
Protein Description | Required for normal hearing. It is necessary for the formation of stereocilia in the inner ear and normal development of the organ of Corti. Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. May play a role in the regulation of transepithelial ion absorption and secretion. Is required for the development and/or maintenance of the proper glomerular endothelial cell and podocyte architecture (By similarity).. | |
Protein Sequence | MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAARHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKLDDYLNTPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVARRLSRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
59 | Acetylation | TTVDLKRKPADLHNL EEECCCCCCCCCCCC | 42.86 | 22902405 | |
87 | Acetylation | DVKTDVNKIEEFLEE CCCCCHHHHHHHHHH | 51.87 | 22902405 | |
100 | Acetylation | EETLTPEKYPKLAAR HHHCCHHHHHHHHHH | 68.97 | 22902405 | |
103 | Acetylation | LTPEKYPKLAARHRE CCHHHHHHHHHHHHC | 47.90 | 22902405 | |
147 | Acetylation | GLTKALRKLDDYLNT HHHHHHHHHHHHHCC | 58.06 | 22902405 | |
169 | Acetylation | TNTHGDEKGSQRKFL CCCCCCCCCCCCCCC | 69.47 | 22902405 | |
196 | Acetylation | LPKLHVVKIVAKKYR CCCCEEEEEEEHHHC | 30.30 | 22902405 | |
196 | Ubiquitination | LPKLHVVKIVAKKYR CCCCEEEEEEEHHHC | 30.30 | - | |
219 | Acetylation | TGLWRYLKNAYARDE HHHHHHHHHHHHCCC | 30.51 | 22902405 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLIC5_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLIC5_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLIC5_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CLIC5_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...