CLE2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CLE2_ARATH
• UniProt AC: O49519
• Protein Name: CLAVATA3/ESR (CLE)-related protein 2
• Gene Name: CLE2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 75
• Subcellular Localization: Secreted, extracellular space .
• Protein Description: Extracellular signal peptide that regulates cell fate. May act with CLV1 as a ligand-receptor pair in a signal transduction pathway, coordinating growth between adjacent meristematic regions..
• Protein Sequence: MAKLSFTFCFLLFLLLSSIAAGSRPLEGARVGVKVRGLSPSIEATSPTVEDDQAAGSHGKSPERLSPGGPDPQHH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
67	Hydroxylation	KSPERLSPGGPDPQH CCHHHCCCCCCCCCC	57.25	19525968
70	Hydroxylation	ERLSPGGPDPQHH-- HHCCCCCCCCCCC--	56.90	19525968
70	O-linked_Glycosylation	ERLSPGGPDPQHH-- HHCCCCCCCCCCC--	56.90	19525968

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CLE2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
70	P	Glycosylation	[CLE2p]: The O-glycosylation (arabinosylation) of the hydroxyproline Pro-70 enhances binding affinity of the CLE2p peptide for its receptor.	19525968

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CLE2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of CLE2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.