UniProt ID | CLE2_ARATH | |
---|---|---|
UniProt AC | O49519 | |
Protein Name | CLAVATA3/ESR (CLE)-related protein 2 | |
Gene Name | CLE2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 75 | |
Subcellular Localization | Secreted, extracellular space . | |
Protein Description | Extracellular signal peptide that regulates cell fate. May act with CLV1 as a ligand-receptor pair in a signal transduction pathway, coordinating growth between adjacent meristematic regions.. | |
Protein Sequence | MAKLSFTFCFLLFLLLSSIAAGSRPLEGARVGVKVRGLSPSIEATSPTVEDDQAAGSHGKSPERLSPGGPDPQHH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
67 | Hydroxylation | KSPERLSPGGPDPQH CCHHHCCCCCCCCCC | 57.25 | 19525968 | |
70 | Hydroxylation | ERLSPGGPDPQHH-- HHCCCCCCCCCCC-- | 56.90 | 19525968 | |
70 | O-linked_Glycosylation | ERLSPGGPDPQHH-- HHCCCCCCCCCCC-- | 56.90 | 19525968 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLE2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
70 | P | Glycosylation |
| 19525968 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLE2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CLE2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...