UniProt ID | CLC1A_HUMAN | |
---|---|---|
UniProt AC | Q8NC01 | |
Protein Name | C-type lectin domain family 1 member A | |
Gene Name | CLEC1A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 280 | |
Subcellular Localization |
Membrane Single-pass type II membrane protein . |
|
Protein Description | ||
Protein Sequence | MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
95 | N-linked_Glycosylation | QMEERLGNTSQELQS HHHHHHCCCHHHHHH | 40.94 | UniProtKB CARBOHYD | |
169 | N-linked_Glycosylation | KYFCLSENSTMLKIN CEEEECCCCEEEEEC | 39.13 | UniProtKB CARBOHYD | |
233 | Phosphorylation | IDVTSPRSRDCVAIL HCCCCCCCCHHHHHH | 35.54 | 25072903 | |
246 | Phosphorylation | ILNGMIFSKDCKELK HHCCEEECCCHHHHH | 19.36 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLC1A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLC1A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLC1A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CCPG1_HUMAN | CCPG1 | physical | 26186194 | |
CCPG1_HUMAN | CCPG1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...