| UniProt ID | CLC1A_HUMAN | |
|---|---|---|
| UniProt AC | Q8NC01 | |
| Protein Name | C-type lectin domain family 1 member A | |
| Gene Name | CLEC1A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 280 | |
| Subcellular Localization |
Membrane Single-pass type II membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 95 | N-linked_Glycosylation | QMEERLGNTSQELQS HHHHHHCCCHHHHHH | 40.94 | UniProtKB CARBOHYD | |
| 169 | N-linked_Glycosylation | KYFCLSENSTMLKIN CEEEECCCCEEEEEC | 39.13 | UniProtKB CARBOHYD | |
| 233 | Phosphorylation | IDVTSPRSRDCVAIL HCCCCCCCCHHHHHH | 35.54 | 25072903 | |
| 246 | Phosphorylation | ILNGMIFSKDCKELK HHCCEEECCCHHHHH | 19.36 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLC1A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLC1A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLC1A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CCPG1_HUMAN | CCPG1 | physical | 26186194 | |
| CCPG1_HUMAN | CCPG1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...