UniProt ID | CL17A_HUMAN | |
---|---|---|
UniProt AC | Q6ZS10 | |
Protein Name | C-type lectin domain family 17, member A | |
Gene Name | CLEC17A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 378 | |
Subcellular Localization |
Membrane Single-pass type II membrane protein . In fibroblasts, expressed on the cell surface. |
|
Protein Description | Cell surface receptor which may be involved in carbohydrate-mediated communication between cells in the germinal center. Binds glycans with terminal alpha-linked mannose or fucose residues.. | |
Protein Sequence | MHNLYSITGYPDPPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYKDLPPKPGSSAPPRPPRAAKETEKPPLPCKPRNMTGLDLAAVTCPPPQLAVNLEPSPLQPSLAATPVPWLNQRSGGPGCCQKRWMVYLCLLVVTSLFLGCLGLTVTLIKYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDCATMNKGGTWNDLSCYKTTYWICERKCSC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
26 | Phosphorylation | EEEEDDDYENSTPPY CHHCCCCCCCCCCCC | 24.81 | - | |
41 | Ubiquitination | KDLPPKPGTMEEEEE CCCCCCCCCCCCHHC | 43.76 | 25015289 | |
47 | Ubiquitination | PGTMEEEEEDDDYEN CCCCCCHHCCCCCCC | 70.75 | 25015289 | |
52 | Phosphorylation | EEEEDDDYENSTPPY CHHCCCCCCCCCCCC | 24.81 | 28348404 | |
55 | Phosphorylation | EDDDYENSTPPYKDL CCCCCCCCCCCCCCC | 30.28 | 28348404 | |
56 | Phosphorylation | DDDYENSTPPYKDLP CCCCCCCCCCCCCCC | 39.60 | 28348404 | |
78 | Phosphorylation | EEEEDDDYENSTPPY CHHCCCCCCCCCCCC | 24.81 | 28348404 | |
81 | Phosphorylation | EDDDYENSTPPYKDL CCCCCCCCCCCCCCC | 30.28 | 28348404 | |
82 | Phosphorylation | DDDYENSTPPYKDLP CCCCCCCCCCCCCCC | 39.60 | 28348404 | |
109 | Ubiquitination | RAAKETEKPPLPCKP CCCCCCCCCCCCCCC | 60.39 | 25015289 | |
115 | Ubiquitination | EKPPLPCKPRNMTGL CCCCCCCCCCCCCCC | 45.10 | 25015289 | |
120 | Phosphorylation | PCKPRNMTGLDLAAV CCCCCCCCCCCEEEE | 37.84 | 28348404 | |
215 | N-linked_Glycosylation | QQMTWRTNMTGMAGL HHHHHHCCCCCHHHH | 19.90 | UniProtKB CARBOHYD | |
237 | N-linked_Glycosylation | ARVRADTNQSLVELW HHHHCCCCCHHHHHH | 29.95 | UniProtKB CARBOHYD | |
285 | N-linked_Glycosylation | ARMFCQENYSHLVII HHHHHHHCCCEEEEE | 20.09 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CL17A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CL17A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CL17A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CL17A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...