| UniProt ID | CL17A_HUMAN | |
|---|---|---|
| UniProt AC | Q6ZS10 | |
| Protein Name | C-type lectin domain family 17, member A | |
| Gene Name | CLEC17A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 378 | |
| Subcellular Localization |
Membrane Single-pass type II membrane protein . In fibroblasts, expressed on the cell surface. |
|
| Protein Description | Cell surface receptor which may be involved in carbohydrate-mediated communication between cells in the germinal center. Binds glycans with terminal alpha-linked mannose or fucose residues.. | |
| Protein Sequence | MHNLYSITGYPDPPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYKDLPPKPGSSAPPRPPRAAKETEKPPLPCKPRNMTGLDLAAVTCPPPQLAVNLEPSPLQPSLAATPVPWLNQRSGGPGCCQKRWMVYLCLLVVTSLFLGCLGLTVTLIKYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDCATMNKGGTWNDLSCYKTTYWICERKCSC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | Phosphorylation | EEEEDDDYENSTPPY CHHCCCCCCCCCCCC | 24.81 | - | |
| 41 | Ubiquitination | KDLPPKPGTMEEEEE CCCCCCCCCCCCHHC | 43.76 | 25015289 | |
| 47 | Ubiquitination | PGTMEEEEEDDDYEN CCCCCCHHCCCCCCC | 70.75 | 25015289 | |
| 52 | Phosphorylation | EEEEDDDYENSTPPY CHHCCCCCCCCCCCC | 24.81 | 28348404 | |
| 55 | Phosphorylation | EDDDYENSTPPYKDL CCCCCCCCCCCCCCC | 30.28 | 28348404 | |
| 56 | Phosphorylation | DDDYENSTPPYKDLP CCCCCCCCCCCCCCC | 39.60 | 28348404 | |
| 78 | Phosphorylation | EEEEDDDYENSTPPY CHHCCCCCCCCCCCC | 24.81 | 28348404 | |
| 81 | Phosphorylation | EDDDYENSTPPYKDL CCCCCCCCCCCCCCC | 30.28 | 28348404 | |
| 82 | Phosphorylation | DDDYENSTPPYKDLP CCCCCCCCCCCCCCC | 39.60 | 28348404 | |
| 109 | Ubiquitination | RAAKETEKPPLPCKP CCCCCCCCCCCCCCC | 60.39 | 25015289 | |
| 115 | Ubiquitination | EKPPLPCKPRNMTGL CCCCCCCCCCCCCCC | 45.10 | 25015289 | |
| 120 | Phosphorylation | PCKPRNMTGLDLAAV CCCCCCCCCCCEEEE | 37.84 | 28348404 | |
| 215 | N-linked_Glycosylation | QQMTWRTNMTGMAGL HHHHHHCCCCCHHHH | 19.90 | UniProtKB CARBOHYD | |
| 237 | N-linked_Glycosylation | ARVRADTNQSLVELW HHHHCCCCCHHHHHH | 29.95 | UniProtKB CARBOHYD | |
| 285 | N-linked_Glycosylation | ARMFCQENYSHLVII HHHHHHHCCCEEEEE | 20.09 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CL17A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CL17A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CL17A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CL17A_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...