| UniProt ID | CKX3_ARATH | |
|---|---|---|
| UniProt AC | Q9LTS3 | |
| Protein Name | Cytokinin dehydrogenase 3 | |
| Gene Name | CKX3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 523 | |
| Subcellular Localization | Endoplasmic reticulum . Vacuole . | |
| Protein Description | Catalyzes the oxidation of cytokinins, a family of N(6)-substituted adenine derivatives that are plant hormones, where the substituent is an isopentenyl group.. | |
| Protein Sequence | MASYNLRSQVRLIAITIVIIITLSTPITTNTSPQPWNILSHNEFAGKLTSSSSSVESAATDFGHVTKIFPSAVLIPSSVEDITDLIKLSFDSQLSFPLAARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVSRTCLYVDVDAAWLWIEVLNKTLELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQITNVLEMDVITGKGEIATCSKDMNSDLFFAVLGGLGQFGIITRARIKLEVAPKRAKWLRFLYIDFSEFTRDQERVISKTDGVDFLEGSIMVDHGPPDNWRSTYYPPSDHLRIASMVKRHRVIYCLEVVKYYDETSQYTVNEEMEELSDSLNHVRGFMYEKDVTYMDFLNRVRTGELNLKSKGQWDVPHPWLNLFVPKTQISKFDDGVFKGIILRNNITSGPVLVYPMNRNKWNDRMSAAIPEEDVFYAVGFLRSAGFDNWEAFDQENMEILKFCEDANMGVIQYLPYHSSQEGWVRHFGPRWNIFVERKYKYDPKMILSPGQNIFQKINSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 92 | Phosphorylation | LIKLSFDSQLSFPLA HHHHHHCCCCCCCEE | 30.89 | 26811356 | |
| 105 | Pros-8alpha-FAD histidine | LAARGHGHSHRGQAS EECCCCCCCCCCCCC | 18.11 | - | |
| 105 | Other | LAARGHGHSHRGQAS EECCCCCCCCCCCCC | 18.11 | - | |
| 153 | N-linked_Glycosylation | WLWIEVLNKTLELGL HHHHHHHHHHHHCCC | 40.20 | - | |
| 408 | N-linked_Glycosylation | KGIILRNNITSGPVL EEEEEECCCCCCCEE | 32.26 | - | |
| 411 | Phosphorylation | ILRNNITSGPVLVYP EEECCCCCCCEEEEE | 36.98 | 19880383 | |
| 417 | Phosphorylation | TSGPVLVYPMNRNKW CCCCEEEEECCCCCC | 7.81 | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CKX3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CKX3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CKX3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CKX3_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
