| UniProt ID | CKLF8_HUMAN | |
|---|---|---|
| UniProt AC | Q8IZV2 | |
| Protein Name | CKLF-like MARVEL transmembrane domain-containing protein 8 | |
| Gene Name | CMTM8 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 173 | |
| Subcellular Localization |
Isoform 1: Membrane Multi-pass membrane protein. Isoform 2: Cytoplasm. Nucleus. |
|
| Protein Description | ||
| Protein Sequence | MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLPGFLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMFVAVFYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | EEPQRARSHTVTTTA CCCCHHHCCCCCCCH | 23.64 | 27732954 | |
| 11 | Phosphorylation | PQRARSHTVTTTASS CCHHHCCCCCCCHHH | 22.31 | 27732954 | |
| 13 | Phosphorylation | RARSHTVTTTASSFA HHHCCCCCCCHHHHH | 21.42 | 28857561 | |
| 14 | Phosphorylation | ARSHTVTTTASSFAE HHCCCCCCCHHHHHH | 18.94 | 28857561 | |
| 15 | Phosphorylation | RSHTVTTTASSFAEN HCCCCCCCHHHHHHH | 18.38 | 28857561 | |
| 17 | Phosphorylation | HTVTTTASSFAENFS CCCCCCHHHHHHHCC | 24.73 | 28857561 | |
| 18 | Phosphorylation | TVTTTASSFAENFST CCCCCHHHHHHHCCC | 26.47 | 28857561 | |
| 24 | Phosphorylation | SSFAENFSTSSSSFA HHHHHHCCCCCCCCC | 38.67 | 26657352 | |
| 25 | Phosphorylation | SFAENFSTSSSSFAY HHHHHCCCCCCCCCC | 28.61 | 26657352 | |
| 26 | Phosphorylation | FAENFSTSSSSFAYD HHHHCCCCCCCCCCC | 27.33 | 28152594 | |
| 27 | Phosphorylation | AENFSTSSSSFAYDR HHHCCCCCCCCCCCH | 30.04 | 28152594 | |
| 28 | Phosphorylation | ENFSTSSSSFAYDRE HHCCCCCCCCCCCHH | 29.28 | 28152594 | |
| 29 | Phosphorylation | NFSTSSSSFAYDREF HCCCCCCCCCCCHHH | 18.82 | 28152594 | |
| 32 | Phosphorylation | TSSSSFAYDREFLRT CCCCCCCCCHHHHHH | 17.33 | 25022875 | |
| 131 | Phosphorylation | VVDASSVSPERDSHN ECCHHHCCCCCCCCC | 24.00 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CKLF8_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CKLF8_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CKLF8_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CKLF8_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...