| UniProt ID | CKLF7_HUMAN | |
|---|---|---|
| UniProt AC | Q96FZ5 | |
| Protein Name | CKLF-like MARVEL transmembrane domain-containing protein 7 | |
| Gene Name | CMTM7 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 175 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | ||
| Protein Sequence | MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSHGAGLVR ------CCCCCCCEE | 30.54 | 28355574 | |
| 10 | Phosphorylation | HGAGLVRTTCSSGSA CCCCCEEECCCCCCC | 25.36 | 28857561 | |
| 11 | Phosphorylation | GAGLVRTTCSSGSAL CCCCEEECCCCCCCC | 10.38 | 27080861 | |
| 13 | Phosphorylation | GLVRTTCSSGSALGP CCEEECCCCCCCCCC | 35.32 | 27080861 | |
| 14 | Phosphorylation | LVRTTCSSGSALGPG CEEECCCCCCCCCCC | 38.62 | 28857561 | |
| 16 | Phosphorylation | RTTCSSGSALGPGAG EECCCCCCCCCCCCC | 23.44 | 27080861 | |
| 28 | Phosphorylation | GAGAAQPSASPLEGL CCCCCCCCCCCCCHH | 29.33 | 27080861 | |
| 30 | Phosphorylation | GAAQPSASPLEGLLD CCCCCCCCCCCHHHC | 34.06 | 27080861 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CKLF7_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CKLF7_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CKLF7_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CKLF7_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
