CKI1_CAEEL - dbPTM
CKI1_CAEEL - PTM Information in dbPTM
Basic Information of Protein
UniProt ID CKI1_CAEEL
UniProt AC Q22197
Protein Name Cyclin-dependent kinase inhibitor 1
Gene Name cki-1
Organism Caenorhabditis elegans.
Sequence Length 184
Subcellular Localization Nucleus .
Protein Description Negative cell-cycle regulator that functions at the G1-to-S-phase transition. It is required for suspension of cell cycling in dauer larvae and starved L1 larvae. In vulval precursor cells (VPCs) a pathway of heterochronic genes acts via cki-1 to maintain VPC in G1 during L2 larval stage. [PubMed: 10587644]
Protein Sequence MSSARRCLFGRPTPEQRSRTRIWLEDAVKRMRQEESQKWGFDFELETPLPSSAGFVYEVIPENCVPEFYRTKVLTVRTTCSSLDISSTTLTPLSSPSTSDKEEPSLMDPNSSFEDEEEPKKWQFREPPTPRKTPTKRQQKMTDFMAVSRKKNSLSPNKLSPVNVIFTPKSRRPTIRTRSSCSPY
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of CKI1_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of CKI1_CAEEL !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of CKI1_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of CKI1_CAEEL !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of CKI1_CAEEL !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of CKI1_CAEEL

loading...

Related Literatures of Post-Translational Modification

TOP