dbPTM

CKI1_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CKI1_CAEEL
UniProt AC	Q22197
Protein Name	Cyclin-dependent kinase inhibitor 1
Gene Name	cki-1
Organism	Caenorhabditis elegans.
Sequence Length	184
Subcellular Localization	Nucleus .
Protein Description	Negative cell-cycle regulator that functions at the G1-to-S-phase transition. It is required for suspension of cell cycling in dauer larvae and starved L1 larvae. In vulval precursor cells (VPCs) a pathway of heterochronic genes acts via cki-1 to maintain VPC in G1 during L2 larval stage. [PubMed: 10587644]
Protein Sequence	MSSARRCLFGRPTPEQRSRTRIWLEDAVKRMRQEESQKWGFDFELETPLPSSAGFVYEVIPENCVPEFYRTKVLTVRTTCSSLDISSTTLTPLSSPSTSDKEEPSLMDPNSSFEDEEEPKKWQFREPPTPRKTPTKRQQKMTDFMAVSRKKNSLSPNKLSPVNVIFTPKSRRPTIRTRSSCSPY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CKI1_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CKI1_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CKI1_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CKI1_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CKI1_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CKI1_CAEEL

Related Literatures of Post-Translational Modification