| UniProt ID | CK2N2_HUMAN | |
|---|---|---|
| UniProt AC | Q96S95 | |
| Protein Name | Calcium/calmodulin-dependent protein kinase II inhibitor 2 | |
| Gene Name | CAMK2N2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 79 | |
| Subcellular Localization | Nucleus. Cytoplasm, cytosol. Excluded from nucleus when coexpressed with activated CAMK2.. | |
| Protein Description | Potent and specific cellular inhibitor of CaM-kinase II (CAMK2). Traps Ca(2+)/calmodulin on CAMK2. May play an important role in the regulation of cell growth when overexpressed in colon adenocarcinoma LoVo cells. Traps Ca(2+)/calmodulin on CAMK2.. | |
| Protein Sequence | MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSEILPYSE ------CCCCCCCCC | 33.09 | - | |
| 7 | Phosphorylation | -MSEILPYSEDKMGR -CCCCCCCCCCCCCC | 22.65 | 24043423 | |
| 8 | Phosphorylation | MSEILPYSEDKMGRF CCCCCCCCCCCCCCC | 37.06 | 24043423 | |
| 35 | Phosphorylation | CRLQDTNSFFAGNQA EEECCCCCCCCCCCC | 24.67 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CK2N2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CK2N2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CK2N2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CK2N2_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...