UniProt ID | CK2N2_HUMAN | |
---|---|---|
UniProt AC | Q96S95 | |
Protein Name | Calcium/calmodulin-dependent protein kinase II inhibitor 2 | |
Gene Name | CAMK2N2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 79 | |
Subcellular Localization | Nucleus. Cytoplasm, cytosol. Excluded from nucleus when coexpressed with activated CAMK2.. | |
Protein Description | Potent and specific cellular inhibitor of CaM-kinase II (CAMK2). Traps Ca(2+)/calmodulin on CAMK2. May play an important role in the regulation of cell growth when overexpressed in colon adenocarcinoma LoVo cells. Traps Ca(2+)/calmodulin on CAMK2.. | |
Protein Sequence | MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSEILPYSE ------CCCCCCCCC | 33.09 | - | |
7 | Phosphorylation | -MSEILPYSEDKMGR -CCCCCCCCCCCCCC | 22.65 | 24043423 | |
8 | Phosphorylation | MSEILPYSEDKMGRF CCCCCCCCCCCCCCC | 37.06 | 24043423 | |
35 | Phosphorylation | CRLQDTNSFFAGNQA EEECCCCCCCCCCCC | 24.67 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CK2N2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CK2N2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CK2N2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CK2N2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...