CK2N2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CK2N2_HUMAN
• UniProt AC: Q96S95
• Protein Name: Calcium/calmodulin-dependent protein kinase II inhibitor 2
• Gene Name: CAMK2N2
• Organism: Homo sapiens (Human).
• Sequence Length: 79
• Subcellular Localization: Nucleus. Cytoplasm, cytosol. Excluded from nucleus when coexpressed with activated CAMK2..
• Protein Description: Potent and specific cellular inhibitor of CaM-kinase II (CAMK2). Traps Ca(2+)/calmodulin on CAMK2. May play an important role in the regulation of cell growth when overexpressed in colon adenocarcinoma LoVo cells. Traps Ca(2+)/calmodulin on CAMK2..
• Protein Sequence: MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSEILPYSE ------CCCCCCCCC	33.09	-
7	Phosphorylation	-MSEILPYSEDKMGR -CCCCCCCCCCCCCC	22.65	24043423
8	Phosphorylation	MSEILPYSEDKMGRF CCCCCCCCCCCCCCC	37.06	24043423
35	Phosphorylation	CRLQDTNSFFAGNQA EEECCCCCCCCCCCC	24.67	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CK2N2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CK2N2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CK2N2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CK2N2_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.