CK2N1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CK2N1_HUMAN
• UniProt AC: Q7Z7J9
• Protein Name: Calcium/calmodulin-dependent protein kinase II inhibitor 1
• Gene Name: CAMK2N1
• Organism: Homo sapiens (Human).
• Sequence Length: 78
• Subcellular Localization: Cell junction, synapse, synaptosome. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density.
• Protein Description: Potent and specific inhibitor of CaM-kinase II (CAMK2)..
• Protein Sequence: MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSEVLPYGD ------CCCCCCCCC	36.09	28348404
53	Phosphorylation	KLGQIGRSKRVVIED CCCCCCCCCEEEEEC	21.43	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CK2N1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CK2N1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CK2N1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CK2N1_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.