| UniProt ID | CJ082_HUMAN | |
|---|---|---|
| UniProt AC | Q8WW14 | |
| Protein Name | Uncharacterized protein C10orf82 | |
| Gene Name | C10orf82 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 234 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEEIYGVSSTKTSAPSPKVLQHEELLPKYPDFSIPDGSCPALGRPLREDPKTPLTCGCAQRPSIPCSGKMYLEPLSSAKYAEG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MEPSKTFMRNL ----CCCCCCHHHCC | 30.90 | 28634298 | |
| 6 | Phosphorylation | --MEPSKTFMRNLPI --CCCCCCHHHCCCC | 27.31 | 28634298 | |
| 14 | Phosphorylation | FMRNLPITPGYSGFV HHHCCCCCCCCCCCC | 14.55 | 28634298 | |
| 17 | Phosphorylation | NLPITPGYSGFVPFL CCCCCCCCCCCCCCE | 13.56 | 28634298 | |
| 18 | Phosphorylation | LPITPGYSGFVPFLS CCCCCCCCCCCCCEE | 31.50 | 28634298 | |
| 41 | Phosphorylation | DMNHCVKTFQEKTQR HHHHHHHHHHHHHHH | 15.34 | 30622161 | |
| 135 | Acetylation | VMAKNCYKDFLEITE EEECCHHHHHHHHHH | 44.17 | 25038526 | |
| 150 | Acetylation | RAKKAHLKPYEEIYG HHHHHCCCCHHHHHC | 35.37 | 25038526 | |
| 179 | Acetylation | QHEELLPKYPDFSIP CCHHHHCCCCCCCCC | 70.19 | 25038526 | |
| 220 | Acetylation | PSIPCSGKMYLEPLS CCCCCCCEEEEEEHH | 14.21 | 25038526 | |
| 227 | Phosphorylation | KMYLEPLSSAKYAEG EEEEEEHHHCCCCCC | 38.68 | 30622161 | |
| 228 | Phosphorylation | MYLEPLSSAKYAEG- EEEEEHHHCCCCCC- | 48.00 | 30622161 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CJ082_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CJ082_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CJ082_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CJ082_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
