| UniProt ID | CISD3_MOUSE | |
|---|---|---|
| UniProt AC | B1AR13 | |
| Protein Name | CDGSH iron-sulfur domain-containing protein 3, mitochondrial | |
| Gene Name | Cisd3 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 137 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Can transfer its iron-sulfur clusters to the apoferrodoxins FDX1 and FDX2. Contributes to mitochondrial iron homeostasis and in maintaining normal levels of free iron and reactive oxygen species, and thereby contributes to normal mitochondrial function.. | |
| Protein Sequence | MGFRRLSFPTDFIFLFPNHICLPALSKPYQRREISSWLARWFPKDPAKPVVAQKTPIRLELVAGKTYRWCVCGRSKNQPFCDGSHFFQRTGLSPLKFKAQETRTVALCTCKATQRPPYCDGTHKSEQVQKAEVGSPL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 48 | Acetylation | WFPKDPAKPVVAQKT HCCCCCCCCEEECCC | 43.67 | 23954790 | |
| 65 | Acetylation | RLELVAGKTYRWCVC EEEEECCCEEEEEEE | 32.42 | 23806337 | |
| 65 | Succinylation | RLELVAGKTYRWCVC EEEEECCCEEEEEEE | 32.42 | - | |
| 65 | Succinylation | RLELVAGKTYRWCVC EEEEECCCEEEEEEE | 32.42 | 23806337 | |
| 81 | S-palmitoylation | RSKNQPFCDGSHFFQ CCCCCCCCCCCCCCC | 8.03 | 28526873 | |
| 81 | S-nitrosylation | RSKNQPFCDGSHFFQ CCCCCCCCCCCCCCC | 8.03 | 21278135 | |
| 81 | S-nitrosocysteine | RSKNQPFCDGSHFFQ CCCCCCCCCCCCCCC | 8.03 | - | |
| 90 | Phosphorylation | GSHFFQRTGLSPLKF CCCCCCCCCCCCCCC | 31.52 | 22807455 | |
| 93 | Phosphorylation | FFQRTGLSPLKFKAQ CCCCCCCCCCCCCCC | 29.54 | 24453211 | |
| 96 | Acetylation | RTGLSPLKFKAQETR CCCCCCCCCCCCCCE | 48.48 | 23576753 | |
| 96 | Succinylation | RTGLSPLKFKAQETR CCCCCCCCCCCCCCE | 48.48 | 23806337 | |
| 98 | Acetylation | GLSPLKFKAQETRTV CCCCCCCCCCCCEEE | 47.80 | 23864654 | |
| 119 | S-nitrosocysteine | ATQRPPYCDGTHKSE CCCCCCCCCCCCCCC | 4.86 | - | |
| 119 | S-nitrosylation | ATQRPPYCDGTHKSE CCCCCCCCCCCCCCC | 4.86 | 21278135 | |
| 119 | S-palmitoylation | ATQRPPYCDGTHKSE CCCCCCCCCCCCCCC | 4.86 | 28526873 | |
| 124 | Acetylation | PYCDGTHKSEQVQKA CCCCCCCCCCCHHHH | 56.37 | 23576753 | |
| 124 | Succinylation | PYCDGTHKSEQVQKA CCCCCCCCCCCHHHH | 56.37 | - | |
| 124 | Succinylation | PYCDGTHKSEQVQKA CCCCCCCCCCCHHHH | 56.37 | 23806337 | |
| 130 | Acetylation | HKSEQVQKAEVGSPL CCCCCHHHHCCCCCC | 47.89 | 23576753 | |
| 135 | Phosphorylation | VQKAEVGSPL----- HHHHCCCCCC----- | 28.36 | 23140645 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CISD3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CISD3_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CISD3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CISD3_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...