CIRBP_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CIRBP_MOUSE
• UniProt AC: P60824
• Protein Name: Cold-inducible RNA-binding protein
• Gene Name: Cirbp
• Organism: Mus musculus (Mouse).
• Sequence Length: 172
• Subcellular Localization: Nucleus, nucleoplasm . Cytoplasm . Translocates from the nucleus to the cytoplasm after exposure to UV radiation (By similarity). Translocates from the nucleus to the cytoplasm into stress granules upon various cytoplasmic stresses, such as osmotic a
• Protein Description: Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN..
• Protein Sequence: MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	KLFVGGLSFDTNEQA CEEECCEECCCCHHH	25.09	26643407
17	Phosphorylation	VGGLSFDTNEQALEQ ECCEECCCCHHHHHH	38.35	26643407
130	Phosphorylation	YGGGRFESRSGGYGG CCCCCCCCCCCCCCC	29.09	29514104
135	Phosphorylation	FESRSGGYGGSRDYY CCCCCCCCCCCCCEE	23.10	29514104
138	Phosphorylation	RSGGYGGSRDYYASR CCCCCCCCCCEEECC	20.02	29899451
139	Methylation	SGGYGGSRDYYASRS CCCCCCCCCEEECCC	38.94	-
141	Phosphorylation	GYGGSRDYYASRSQG CCCCCCCEEECCCCC	10.38	29514104
145	Methylation	SRDYYASRSQGGSYG CCCEEECCCCCCCCC	25.48	-
146	Phosphorylation	RDYYASRSQGGSYGY CCEEECCCCCCCCCC	30.59	29899451
151	Phosphorylation	SRSQGGSYGYRSSGG CCCCCCCCCCCCCCC	22.81	29514104
155	Phosphorylation	GGSYGYRSSGGSYRD CCCCCCCCCCCCCCC	25.50	23737553
156	Phosphorylation	GSYGYRSSGGSYRDS CCCCCCCCCCCCCCC	37.87	23737553
159	Phosphorylation	GYRSSGGSYRDSYDS CCCCCCCCCCCCCCC	22.11	23737553
160	Phosphorylation	YRSSGGSYRDSYDSY CCCCCCCCCCCCCCC	23.01	23737553
163	Phosphorylation	SGGSYRDSYDSYATH CCCCCCCCCCCCCCC	23.11	29899451
164	Phosphorylation	GGSYRDSYDSYATHN CCCCCCCCCCCCCCC	17.13	26643407
166	Phosphorylation	SYRDSYDSYATHNE- CCCCCCCCCCCCCC-	14.40	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CIRBP_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CIRBP_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CIRBP_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CIRBP_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.