CIDEA_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CIDEA_MOUSE
• UniProt AC: O70302
• Protein Name: Cell death activator CIDE-A
• Gene Name: Cidea
• Organism: Mus musculus (Mouse).
• Sequence Length: 217
• Subcellular Localization: Lipid droplet. Nucleus. Enriched at lipid droplet contact sites. Using a GFP-tagged construct, has been shown to localize to mitonchondria, where it could interact with UCP1 and hence inhibit UCP1 uncoupling activity (PubMed:12910269). These data cou
• Protein Description: Binds to lipid droplets and regulates their enlargement, thereby restricting lipolysis and favoring storage. At focal contact sites between lipid droplets, promotes directional net neutral lipid transfer from the smaller to larger lipid droplets. The transfer direction may be driven by the internal pressure difference between the contacting lipid droplet pair and occurs at a lower rate than that promoted by CIDEC. Acts as a CEBPB coactivator in mammary epithelial cells to control the expression of a subset of CEBPB downstream target genes, including ID2, IGF1, PRLR, SOCS1, SOCS3, XDH, but not casein. By interacting with CEBPB, strengthens the association of CEBPB with the XDH promoter, increases histone acetylation and dissociates HDAC1 from the promoter. When overexpressed, induces apoptosis. The physiological significance of its role in apoptosis is unclear..
• Protein Sequence: METARDYAGALIRPLTFMGLQTKKVLLTPLIHPARPFRVSNHDRSSRRGVMASSLQELISKTLDVLVITTGLVTLVLEEDGTVVDTEEFFQTLRDNTHFMILEKGQKWTPGSKYVPVCKQPKKSGIARVTFDLYRLNPKDFLGCLNVKATMYEMYSVSYDIRCTSFKAVLRNLLRFMSYAAQMTGQFLVYAGTYMLRVLGDTEEQPSPKPSTKGWFM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CIDEA_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CIDEA_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CIDEA_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CIDEA_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AAPK1_MOUSE	Prkaa1	physical	18480843
AAKB1_MOUSE	Prkab1	physical	18480843
AAKG1_MOUSE	Prkag1	physical	18480843

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.