CIB2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CIB2_HUMAN
• UniProt AC: O75838
• Protein Name: Calcium and integrin-binding family member 2
• Gene Name: CIB2
• Organism: Homo sapiens (Human).
• Sequence Length: 187
• Subcellular Localization: Cytoplasm . Cell projection, stereocilium . Photoreceptor inner segment . Cell projection, cilium, photoreceptor outer segment . Cell membrane, sarcolemma . Colocalized with ITGA7 at the myotendinous junctions (MTJ) and at the neuromuscular junctions
• Protein Description: Calcium-binding protein critical for proper photoreceptor cell maintenance and function. Plays a role in intracellular calcium homeostasis by decreasing ATP-induced calcium release. [PubMed: 23023331]
• Protein Sequence: MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MGNKQTIFTEEQL --CCCCCEECCHHHH	21.48	24719451
9	Phosphorylation	GNKQTIFTEEQLDNY CCCCEECCHHHHHCC	34.46	24719451
20	Phosphorylation	LDNYQDCTFFNKKDI HHCCCCCCCCCHHHH	39.28	24719451
49	Phosphorylation	VPMDYRKSPIVHVPM CCCCCCCCCCEEEEH	15.74	28634298
57	Phosphorylation	PIVHVPMSLIIQMPE CCEEEEHHHHCCCHH	15.45	28634298
131	Phosphorylation	CKEDLELTLARLTKS EHHHHHHHHHHHHHH	14.70	24719451
181	Phosphorylation	AKAPDFLSTFHIRI- HHCCCHHHEEEEEC-	29.08	30631047
182	Phosphorylation	KAPDFLSTFHIRI-- HCCCHHHEEEEEC--	22.75	30631047

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CIB2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CIB2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CIB2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CIB2_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.