dbPTM

CIAO1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CIAO1_MOUSE
UniProt AC	Q99KN2
Protein Name	Probable cytosolic iron-sulfur protein assembly protein CIAO1 {ECO:0000255\|HAMAP-Rule:MF_03037}
Gene Name	Ciao1 {ECO:0000255\|HAMAP-Rule:MF_03037}
Organism	Mus musculus (Mouse).
Sequence Length	339
Subcellular Localization
Protein Description	Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation..
Protein Sequence	MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLSSHTQDVKHVVWHPSQELLASASYDDTVKLYQEEGDDWVCCATLEGHESTVWSIAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHTRTIYDVAWCQLTGALATACGDDAIRVFEEDPGSDPQQPTFSLTAHLRQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWEYHQPAGL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Ubiquitination	------MKDSLVLQS ------CCCEEEEEC	56.90	22790023
54	Phosphorylation	GDSWICKSVLSEGHQ CCCCCHHHHCCCCCC	24.71	22871156
57	Phosphorylation	WICKSVLSEGHQRTV CCHHHHCCCCCCCCE	39.10	22871156
245	S-nitrosocysteine	DPSWKCICTLSGFHT CCCCEEEEEECCCCC	4.37	-
245	S-nitrosylation	DPSWKCICTLSGFHT CCCCEEEEEECCCCC	4.37	20925432

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CIAO1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CIAO1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CIAO1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CIAO1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CIAO1_MOUSE

Related Literatures of Post-Translational Modification