CI163_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CI163_HUMAN
• UniProt AC: Q8N9P6
• Protein Name: Uncharacterized protein C9orf163
• Gene Name: C9orf163
• Organism: Homo sapiens (Human).
• Sequence Length: 203
• Protein Sequence: MPGPLTCTPAWQGQGRAAAFLCCSFQRAGAVVGVPARWHRGRLSSQQRLRSSLGGSHPCPQLGRRLVREGVISVPRQQGRRRCRESFSPADVAPGPICSANICLSGVRFLTCLNRVREHVVGPSPSPAAPICFFPVVEALCTLRGRRCHCLPFPKRGMQRWMLPLRRGARLLPLASSKNPRARSPGLDPLGSSETLWSHRGGH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Methylation	PAWQGQGRAAAFLCC CCCCCCCCHHHHHHH	17.11	-
73	Phosphorylation	LVREGVISVPRQQGR HHHCCCCCCCHHHCH	24.54	24719451
105	Phosphorylation	CSANICLSGVRFLTC CCCEEEECCHHHHHH	30.72	24719451
176	Phosphorylation	ARLLPLASSKNPRAR CHHHHHCCCCCCCCC	49.91	23403867
177	Phosphorylation	RLLPLASSKNPRARS HHHHHCCCCCCCCCC	30.74	23403867
184	Phosphorylation	SKNPRARSPGLDPLG CCCCCCCCCCCCCCC	23.49	29457462
198	Phosphorylation	GSSETLWSHRGGH-- CCCCCCHHCCCCC--	13.35	29457462

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CI163_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CI163_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CI163_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CI163_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.