CI062_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CI062_HUMAN
• UniProt AC: Q8N4C0
• Protein Name: Putative uncharacterized protein C9orf62
• Gene Name: C9orf62
• Organism: Homo sapiens (Human).
• Sequence Length: 152
• Protein Sequence: MGLSPGQTSVSFLWPLLEVRDHNTGRGLVPATVLTPGSPETLLELRQAFLGSRQARHGHDAAPSSGQQGCSVDRTAGRPVLGWRLRNSLTGQEGRQHLHLSGIRTSRKAKEYKPVFFGATEISVLMAVAESLREPPPPQWGWFLSSLFLKIF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
32	Phosphorylation	GRGLVPATVLTPGSP CCCEEEEEEECCCCH	15.24	22210691
35	Phosphorylation	LVPATVLTPGSPETL EEEEEEECCCCHHHH	22.67	22210691
38	Phosphorylation	ATVLTPGSPETLLEL EEEECCCCHHHHHHH	22.29	22210691
101	Phosphorylation	GRQHLHLSGIRTSRK CCEEEEECCCCCCCC	22.79	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CI062_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CI062_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CI062_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CI062_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.