UniProt ID | CHCH5_HUMAN | |
---|---|---|
UniProt AC | Q9BSY4 | |
Protein Name | Coiled-coil-helix-coiled-coil-helix domain-containing protein 5 | |
Gene Name | CHCHD5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 110 | |
Subcellular Localization | Mitochondrion intermembrane space . | |
Protein Description | ||
Protein Sequence | MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MQAALEVT -------CCHHHHHH | 5.73 | 22814378 | |
8 | Phosphorylation | MQAALEVTARYCGRE CCHHHHHHHHHHCCH | 8.95 | 24043423 | |
26 | Ubiquitination | YGQCVAAKPESWQRD HCCEEECCCCHHHHH | 39.31 | - | |
98 | Phosphorylation | EQVQPPRSPATVEAQ HHCCCCCCCCCEECC | 25.35 | 28555341 | |
101 | Phosphorylation | QPPRSPATVEAQPLP CCCCCCCCEECCCCC | 23.43 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CHCH5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CHCH5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CHCH5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CHCH5_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...