dbPTM

CH15_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CH15_DROME
UniProt AC	P07185
Protein Name	Chorion protein S15
Gene Name	Cp15
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	115
Subcellular Localization	Secreted.
Protein Description	Chorion membrane (egg shell) protein; plays a role in protecting the egg from the environment..
Protein Sequence	MKYLIVCVTLALFAYINASPAYGNRGGYGGGYGGGYGPVQRVVYEEVPAYGPSRGYNSYPRSLRSEGNGGSAAAAAAASAAAVNPGTYKQYAIPSYELDGARGYEIGHGYGQRAY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CH15_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CH15_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CH15_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CH15_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ATRIP_DROME	mus304	physical	14605208
ITA3_DROME	scb	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CH15_DROME

Related Literatures of Post-Translational Modification