UniProt ID | CH10_ARATH | |
---|---|---|
UniProt AC | P34893 | |
Protein Name | 10 kDa chaperonin, mitochondrial | |
Gene Name | CPN10 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 98 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Seems to function only as a co-chaperone, along with CPN60, and in certain cases is essential for the discharge of biologically active proteins from CPN60.. | |
Protein Sequence | MMKRLIPTFNRILVQRVIQPAKTESGILLPEKSSKLNSGKVIAVGPGSRDKDGKLIPVSVKEGDTVLLPEYGGTQVKLGENEYHLFRDEDVLGTLHED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Acetylation | QRVIQPAKTESGILL HHHHCCCCCCCCEEC | 60.55 | 24727099 | |
32 | Acetylation | SGILLPEKSSKLNSG CCEECCCCCCCCCCC | 59.08 | 24727099 | |
33 | Phosphorylation | GILLPEKSSKLNSGK CEECCCCCCCCCCCC | 30.92 | 25561503 | |
34 | Phosphorylation | ILLPEKSSKLNSGKV EECCCCCCCCCCCCE | 52.83 | 23111157 | |
40 | Acetylation | SSKLNSGKVIAVGPG CCCCCCCCEEEECCC | 30.23 | 24727099 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CH10_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CH10_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CH10_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CH10_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...