CH082_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CH082_HUMAN
• UniProt AC: Q6P1X6
• Protein Name: UPF0598 protein C8orf82
• Gene Name: C8orf82
• Organism: Homo sapiens (Human).
• Sequence Length: 216
• Protein Sequence: MWPPCGTLRTLALARSRGARACSGDGGVSYTQGQSPEPRTREYFYYVDHQGQLFLDDSKMKNFITCFKDPQFLVTFFSRLRPNRSGRYEAAFPFLSPCGRERNFLRCEDRPVVFTHLLTADHGPPRLSYCGGGEALAVPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEYGPGAPALPSHVRWQGRRLALTMDLAPLLLAARSP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MWPPCGTLRTLALA -CCCCCHHHHHHHHH	21.56	24043423
10	Phosphorylation	PPCGTLRTLALARSR CCCHHHHHHHHHHHC	21.35	24043423
98	S-nitrosocysteine	AFPFLSPCGRERNFL EEEEECCCCCCCCEE	7.83	-
98	S-nitrosylation	AFPFLSPCGRERNFL EEEEECCCCCCCCEE	7.83	19483679
215	Phosphorylation	PLLLAARSP------ HHHHHHCCC------	30.18	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CH082_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CH082_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CH082_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CH082_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.