CH037_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CH037_MOUSE
• UniProt AC: Q3UJP5
• Protein Name: Protein C8orf37 homolog
• Organism: Mus musculus (Mouse).
• Sequence Length: 209
• Subcellular Localization: Cytoplasm . Photoreceptor inner segment . In the retina, located at the base of the primary cilium (PubMed:22177090). Expressed throughout photoreceptors cell body including the basal body, inner segment and synaptic terminus, but not in the outer se
• Protein Description: May be involved in photoreceptor outer segment disk morphogenesis..
• Protein Sequence: MAKDLDELLDEVETKFCRLDPLRLDLGERPKGDGGGGSHSGDRNGAQEKETLRSTETFKKEDDLDSLINEIFEEPDFDRKSFQKFKSKSSSNTCVRAPMQGVSKSCSPVYLSGSAIPCGIGTNTSQRACDRLRCVACDFRIVSYNDYMWDKSCDYLFFRNNMPEFHKLKTKLIEKKGARAYACQCSWRTVEELTDLQTDHQLRWVCGKH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
66	Phosphorylation	KKEDDLDSLINEIFE CCHHHHHHHHHHHHH	38.15	29550500
105	Phosphorylation	PMQGVSKSCSPVYLS CCCCCCCCCCCEEEC	16.60	25293948
107	Phosphorylation	QGVSKSCSPVYLSGS CCCCCCCCCEEECCC	25.21	25293948
110	Phosphorylation	SKSCSPVYLSGSAIP CCCCCCEEECCCCCC	9.87	25293948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CH037_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CH037_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CH037_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CH037_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.