UniProt ID | CH037_MOUSE | |
---|---|---|
UniProt AC | Q3UJP5 | |
Protein Name | Protein C8orf37 homolog | |
Gene Name | ||
Organism | Mus musculus (Mouse). | |
Sequence Length | 209 | |
Subcellular Localization | Cytoplasm . Photoreceptor inner segment . In the retina, located at the base of the primary cilium (PubMed:22177090). Expressed throughout photoreceptors cell body including the basal body, inner segment and synaptic terminus, but not in the outer se | |
Protein Description | May be involved in photoreceptor outer segment disk morphogenesis.. | |
Protein Sequence | MAKDLDELLDEVETKFCRLDPLRLDLGERPKGDGGGGSHSGDRNGAQEKETLRSTETFKKEDDLDSLINEIFEEPDFDRKSFQKFKSKSSSNTCVRAPMQGVSKSCSPVYLSGSAIPCGIGTNTSQRACDRLRCVACDFRIVSYNDYMWDKSCDYLFFRNNMPEFHKLKTKLIEKKGARAYACQCSWRTVEELTDLQTDHQLRWVCGKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
66 | Phosphorylation | KKEDDLDSLINEIFE CCHHHHHHHHHHHHH | 38.15 | 29550500 | |
105 | Phosphorylation | PMQGVSKSCSPVYLS CCCCCCCCCCCEEEC | 16.60 | 25293948 | |
107 | Phosphorylation | QGVSKSCSPVYLSGS CCCCCCCCCEEECCC | 25.21 | 25293948 | |
110 | Phosphorylation | SKSCSPVYLSGSAIP CCCCCCEEECCCCCC | 9.87 | 25293948 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CH037_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CH037_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CH037_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CH037_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...