dbPTM

CH037_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CH037_HUMAN
UniProt AC	Q96NL8
Protein Name	Protein C8orf37
Gene Name	C8orf37
Organism	Homo sapiens (Human).
Sequence Length	207
Subcellular Localization	Cytoplasm . Photoreceptor inner segment . In the retina, located at the base of the primary cilium (PubMed:22177090). Expressed throughout photoreceptors cell body including the basal body, inner segment and synaptic terminus, but not in the outer se
Protein Description	May be involved in photoreceptor outer segment disk morphogenesis (By similarity)..
Protein Sequence	MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINEILEEPNLDKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGTNISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYACQCSWRTIEEVTDLQTDHQLRWVCGKH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	EVESKFCTPDLLRRG HHHHHCCCHHHHHCC	23.99	21815630
65	Phosphorylation	KKEDDLDSLINEILE CCHHHHHHHHHHHHH	38.15	20873877
92	Phosphorylation	SKSSGNTSVRASIEG CCCCCCCCHHHEEEC	17.38	28555341
96	Phosphorylation	GNTSVRASIEGLGKS CCCCHHHEEECCCCC	15.60	25159151
123	Phosphorylation	CGIGTNISWRACDHL CCCCCCCCHHHCCHH	16.75	24719451
187	Phosphorylation	ACQCSWRTIEEVTDL EEECCCEEHHHHHCC	26.87	28192239

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CH037_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CH037_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CH037_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CPNS1_HUMAN	CAPNS1	physical	27173435
CYTM_HUMAN	CST6	physical	27173435

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CH037_HUMAN

Related Literatures of Post-Translational Modification