| UniProt ID | CFA20_DROME | |
|---|---|---|
| UniProt AC | Q9VKV8 | |
| Protein Name | Cilia- and flagella-associated protein 20 | |
| Gene Name | Bug22 {ECO:0000312|FlyBase:FBgn0032248} | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 199 | |
| Subcellular Localization | Nucleus . Nucleus, nucleolus . Cell projection, cilium . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole . Cell projection, cilium, flagellum . Localizes in cilia of chordotonal organs in sensory neurons of the antenna. | |
| Protein Description | Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for sperm individualization, differentiation of the sperm flagellum and tubulin polyglycylation of axonemal microtubules.. | |
| Protein Sequence | MFKNTFQSGFLSILYSIGSKPLQLWDKKVRNGHIKRITDNDIQSLVLEIVGTNVSTTFITCPADPKKTLGIKLPFLVMIIKNMKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDEGWNQIQFNLSDFTRRAYGTNYVETLRVQIHANCRIRRVYFSDRLYSEDELPPEFKLFLPIQKPVQKSNAICS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 189 | Acetylation | KLFLPIQKPVQKSNA EEEEECCCCCCCCCC | 21791702 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CFA20_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CFA20_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CFA20_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TTL3B_DROME | TTLL3B | genetic | 24414207 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...