UniProt ID | CF157_HUMAN | |
---|---|---|
UniProt AC | Q5JU67 | |
Protein Name | Cilia- and flagella-associated protein 157 {ECO:0000305} | |
Gene Name | CFAP157 {ECO:0000312|HGNC:HGNC:27843} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 520 | |
Subcellular Localization | Cytoplasm, cytoskeleton, cilium basal body . | |
Protein Description | Specifically required during spermatogenesis for flagellum morphogenesis and sperm motility. May be required to suppress the formation of supernumerary axonemes and ensure a correct ultrastructure.. | |
Protein Sequence | MAPKKSVSKAGKELEVKKKGGKKEPVVAVEPPLAKEMKEFYHIQIRDLEDRLARYQRKWDELAVQEKMFRQEFEQLANNKKEIVAFLKRTLNQQVDEITDLNEQLQNLQLAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKEEVTDKFTLLEEQVRKQENEFRDYAYNLEKKSVLDKDRLRKEIIQRVNLVANEFHKVTTNRMWETTKRAIKENNGITLQMARVSQQGMKLLQENEQLKGRQNNLCKQLELLENTQKVMARHKRGHQKIILMLTKKCQEQQQDTKEAEELRLLLSQLEQRSLQLQVDNQALKSQRDQLSLQLEQQQVDLQRLQQELANEQKVRASLEAALVQATSFLQNILQMHRDEEDSDVDVTFQPWHKEMLQQLLVMLSSTVATRPQKAACPHQESQSHGPPKESRPSIQLPRTGSLLPQLSDITPYQPGDLGLVPRQVHIPPNPQDLRLLSYITRVGTFRAHSSPEMRAPGSLKRLEKFSLPEVPLRPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
35 | Acetylation | AVEPPLAKEMKEFYH EECCCCHHHHHHHHC | 19666963 | ||
81 | Ubiquitination | EQLANNKKEIVAFLK HHHHCCHHHHHHHHH | - | ||
184 | Phosphorylation | NEFRDYAYNLEKKSV HHHHHHHHHHHCCCC | 22468782 | ||
312 | Phosphorylation | EELRLLLSQLEQRSL HHHHHHHHHHHHHHH | - | ||
444 | Phosphorylation | PSIQLPRTGSLLPQL CCCCCCCCCCCCCCH | 25693802 | ||
446 | Phosphorylation | IQLPRTGSLLPQLSD CCCCCCCCCCCCHHC | 25693802 | ||
489 | Phosphorylation | SYITRVGTFRAHSSP HHHHCCCCCCCCCCC | 24719451 | ||
494 | Phosphorylation | VGTFRAHSSPEMRAP CCCCCCCCCCCCCCC | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CF157_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CF157_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CF157_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CF157_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...