UniProt ID | CF136_HUMAN | |
---|---|---|
UniProt AC | Q5SQH8 | |
Protein Name | Uncharacterized protein C6orf136 | |
Gene Name | C6orf136 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 315 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MYQPSRGAARRLGPCLRAYQARPQDQLYPGTLPFPPLWPHSTTTTSPSSPLFWSPLPPRLPTQRLPQVPPLPLPQIQALSSAWVVLPPGKGEEGPGPELHSGCLDGLRSLFEGPPCPYPGAWIPFQVPGTAHPSPATPSGDPSMEEHLSVMYERLRQELPKLFLQSHDYSLYSLDVEFINEILNIRTKGRTWYILSLTLCRFLAWNYFAHLRLEVLQLTRHPENWTLQARWRLVGLPVHLLFLRFYKRDKDEHYRTYDAYSTFYLNSSGLICRHRLDKLMPSHSPPTPVKKLLVGALVALGLSEPEPDLNLCSKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MYQPSRGAA ------CCCCCHHHH | 29.18 | 24719451 | |
5 | Phosphorylation | ---MYQPSRGAARRL ---CCCCCHHHHHHH | 28.02 | 24719451 | |
19 | Phosphorylation | LGPCLRAYQARPQDQ HHHHHHHHHCCCCCC | 9.03 | 24719451 | |
41 (in isoform 4) | Phosphorylation | - | 24.30 | 29743597 | |
118 (in isoform 4) | Phosphorylation | - | 22.48 | - | |
146 (in isoform 4) | Phosphorylation | - | 41.30 | - | |
282 | Phosphorylation | RLDKLMPSHSPPTPV HHHHHCCCCCCCCHH | 23.72 | 22496350 | |
284 | Phosphorylation | DKLMPSHSPPTPVKK HHHCCCCCCCCHHHH | 36.59 | 22496350 | |
287 | Phosphorylation | MPSHSPPTPVKKLLV CCCCCCCCHHHHHHH | 44.06 | - | |
290 | Ubiquitination | HSPPTPVKKLLVGAL CCCCCHHHHHHHHHH | 38.62 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CF136_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CF136_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CF136_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CF136_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...