UniProt ID | CERS4_MOUSE | |
---|---|---|
UniProt AC | Q9D6J1 | |
Protein Name | Ceramide synthase 4 | |
Gene Name | Cers4 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 393 | |
Subcellular Localization |
Nucleus membrane Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing different fatty acid donors (N-linked stearoyl- (C18) or arachidoyl- (C20) ceramides) in a fumonisin B1-independent manner.. | |
Protein Sequence | MSFSLSEWLWQETYWLPPNVTWAELEDRDGLVFAHPHHVLAAFPVALVLVAVRIVFERFVALPLSRWMGVQDPIRRKIKPNPVLEKYFLRMKQCPEETQMVLLASQCGLTLRQTQRWFRRRRNQDRPSLSKKFCEACWRFVFYLCSFVGGTSILYHESWLWSPSLCWENYPHQTLNLSLYWWYLLELGFYLSLLITLPFDVKRKDFKEQVVHHFVAVGLIGFSYSVNLLRIGAVVLLLHDCSDYLLEGCKILNYAHFRRGCDALFIMFALVFFYTRLIFFPTQVIYTSVYDSIKNSGPFFGYYFFIVLLVMLQILHVYWFCLILRMLYSFLHKGQMTEDIRSDVEEPDSSDDEPVSEGPQLKNGMARGSRVAVTNGPRSRAAACLTNGHTRAT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | N-linked_Glycosylation | ETYWLPPNVTWAELE HHCCCCCCCEEEEEE | 41.74 | - | |
337 | Phosphorylation | FLHKGQMTEDIRSDV HHHCCCCCHHHHHCC | 23.71 | 24704852 | |
342 | Phosphorylation | QMTEDIRSDVEEPDS CCCHHHHHCCCCCCC | 46.47 | 21082442 | |
349 | Phosphorylation | SDVEEPDSSDDEPVS HCCCCCCCCCCCCCC | 46.51 | 21082442 | |
350 | Phosphorylation | DVEEPDSSDDEPVSE CCCCCCCCCCCCCCC | 57.36 | 21082442 | |
356 | Phosphorylation | SSDDEPVSEGPQLKN CCCCCCCCCCHHHCC | 47.77 | 28066266 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CERS4_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CERS4_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CERS4_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CERS4_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-349 AND SER-350, ANDMASS SPECTROMETRY. |