CERS4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CERS4_HUMAN
• UniProt AC: Q9HA82
• Protein Name: Ceramide synthase 4
• Gene Name: CERS4
• Organism: Homo sapiens (Human).
• Sequence Length: 394
• Subcellular Localization: Nucleus membrane ; Multi-pass membrane protein . Endoplasmic reticulum membrane; Multi-pass membrane protein.
• Protein Description: May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing different fatty acid donors (N-linked stearoyl- (C18) or arachidoyl- (C20) ceramides) in a fumonisin B1-independent manner (By similarity)..
• Protein Sequence: MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFFGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPLQLKNGAAGGPRPAPTDGPRSRVAGRLTNRHTTAT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	N-linked_Glycosylation	DRFWLPPNVTWTELE CCCCCCCCCEEEEEE	41.74	-
83	Phosphorylation	RQVKPNATLEKHFLT CCCCCCCCHHHHHCC	41.93	24719451
342	Phosphorylation	QMEKDIRSDVEESDS CCHHHHHHHCCCCCC	46.47	26503892
347	Phosphorylation	IRSDVEESDSSEEAA HHHHCCCCCCHHHHH	29.32	30278072
349	Phosphorylation	SDVEESDSSEEAAAA HHCCCCCCHHHHHHH	49.26	26503892
350	Phosphorylation	DVEESDSSEEAAAAQ HCCCCCCHHHHHHHH	44.43	26503892

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
342	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
347	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
349	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
350	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CERS4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CERS4_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CERS4_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.