| UniProt ID | CERS1_HUMAN | |
|---|---|---|
| UniProt AC | P27544 | |
| Protein Name | Ceramide synthase 1 | |
| Gene Name | CERS1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 350 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Isoform 1: Endoplasmic reticulum membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. Isoform 1 may recycle from the Golgi to the endoplasmic retic |
|
| Protein Description | May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner (By similarity).. | |
| Protein Sequence | MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPELLLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLLFGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVMLLHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAADLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFLYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAAAGPAAG ------CCCCCCCCC | 13.15 | 22223895 | |
| 29 | Phosphorylation | LVQRGWGSALAAARG HHHCCHHHHHHHHCC | 17.38 | - | |
| 87 | Ubiquitination | RLFRPLAKRCCLQPR HHHHHHHHHHCCCCC | 54.36 | - | |
| 98 | Ubiquitination | LQPRDAAKMPESAWK CCCCHHHHCCHHHHH | 57.62 | - | |
| 226 | Ubiquitination | TKLNIYFKSRGGSYH EEEEEEEECCCCCHH | 23.44 | - | |
| 301 | Phosphorylation | MNLYWFLYIVAFAAK HHHHHHHHHHHHHHH | 5.49 | 18083107 | |
| 318 | Ubiquitination | TGQVHELKDLREYDT HCCCCCCHHHHCCCC | 52.29 | 21890473 | |
| 318 (in isoform 1) | Ubiquitination | - | 52.29 | 21890473 | |
| 318 (in isoform 2) | Ubiquitination | - | 52.29 | 21890473 | |
| 323 | Phosphorylation | ELKDLREYDTAEAQS CCHHHHCCCCHHHHH | 16.50 | 27642862 | |
| 332 | Ubiquitination | TAEAQSLKPSKAEKP CHHHHHCCCCCCCCC | 53.12 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CERS1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CERS1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CERS1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CERS1_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| 616230 | Epilepsy, progressive myoclonic 8 (EPM8) | |||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
