| UniProt ID | CER2_ARATH | |
|---|---|---|
| UniProt AC | Q39048 | |
| Protein Name | Protein ECERIFERUM 2 | |
| Gene Name | CER2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 421 | |
| Subcellular Localization | Endoplasmic reticulum. Nucleus . | |
| Protein Description | Involved in biosynthesis of the epicuticular wax. Plays a role in very-long-chain fatty acid (VLCFA) biosynthesis and is required for C28 fatty acid elongation in stem. Despite its classification as a BAHD acyltransferase based on sequence homology, CER2 does not seem to share the catalytic mechanism of the members of the BAHD family.. | |
| Protein Sequence | MEGSPVTSVRLSSVVPASVVGENKPRQLTPMDLAMKLHYVRAVYFFKGARDFTVADVKNTMFTLQSLLQSYHHVSGRIRMSDNDNDTSAAAIPYIRCNDSGIRVVEANVEEFTVEKWLELDDRSIDHRFLVYDHVLGPDLTFSPLVFLQITQFKCGGLCIGLSWAHILGDVFSASTFMKTLGQLVSGHAPTKPVYPKTPELTSHARNDGEAISIEKIDSVGEYWLLTNKCKMGRHIFNFSLNHIDSLMAKYTTRDQPFSEVDILYALIWKSLLNIRGETNTNVITICDRKKSSTCWNEDLVISVVEKNDEMVGISELAALIAGEKREENGAIKRMIEQDKGSSDFFTYGANLTFVNLDEIDMYELEINGGKPDFVNYTIHGVGDKGVVLVFPKQNFARIVSVVMPEEDLAKLKEEVTNMII | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEGSPVTS -------CCCCCCCE | 22223895 | ||
| 4 | Phosphorylation | ----MEGSPVTSVRL ----CCCCCCCEEEE | 25561503 | ||
| 7 | Phosphorylation | -MEGSPVTSVRLSSV -CCCCCCCEEEECCE | 25561503 | ||
| 8 | Phosphorylation | MEGSPVTSVRLSSVV CCCCCCCEEEECCEE | 25561503 | ||
| 198 | Phosphorylation | TKPVYPKTPELTSHA CCCCCCCCHHHCCCC | 29654922 | ||
| 202 | Phosphorylation | YPKTPELTSHARNDG CCCCHHHCCCCCCCC | 29654922 | ||
| 259 | Phosphorylation | TTRDQPFSEVDILYA CCCCCCCCHHHHHHH | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CER2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CER2_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CER2_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CER2_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
