| UniProt ID | CEND_RAT | |
|---|---|---|
| UniProt AC | Q5FVI4 | |
| Protein Name | Cell cycle exit and neuronal differentiation protein 1 | |
| Gene Name | Cend1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 149 | |
| Subcellular Localization |
Membrane Single-pass type IV membrane protein . |
|
| Protein Description | Involved in neuronal differentiation.. | |
| Protein Sequence | MESRGKSASSPKPDTKVPQATAEAKATPAADGKAPLTKPVKKDAQAEKQEQPAAPGPATTKKTPAKADPVLLNNHSNLKPAPTVPAAPSSPDTTSEPKGPGDGAEEDESNTGGRGPWPCENLTPLLVAGGVAVATIALILGVAFLARKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MESRGKSASSPKPD -CCCCCCCCCCCCCC | 35.89 | 28551015 | |
| 9 | Phosphorylation | ESRGKSASSPKPDTK CCCCCCCCCCCCCCC | 55.02 | 28551015 | |
| 10 | Phosphorylation | SRGKSASSPKPDTKV CCCCCCCCCCCCCCC | 36.34 | 25403869 | |
| 12 | Ubiquitination | GKSASSPKPDTKVPQ CCCCCCCCCCCCCCH | 58.43 | - | |
| 15 | Phosphorylation | ASSPKPDTKVPQATA CCCCCCCCCCCHHHH | 42.33 | 28551015 | |
| 25 | Ubiquitination | PQATAEAKATPAADG CHHHHHHHCCCCCCC | 44.28 | - | |
| 38 | Ubiquitination | DGKAPLTKPVKKDAQ CCCCCCCCCCHHHHH | 56.34 | - | |
| 48 | Ubiquitination | KKDAQAEKQEQPAAP HHHHHHHHHCCCCCC | 63.25 | - | |
| 61 | Ubiquitination | APGPATTKKTPAKAD CCCCCCCCCCCCCCC | 50.74 | - | |
| 62 | Ubiquitination | PGPATTKKTPAKADP CCCCCCCCCCCCCCC | 58.61 | - | |
| 89 | Phosphorylation | PTVPAAPSSPDTTSE CCCCCCCCCCCCCCC | 50.18 | 28551015 | |
| 90 | Phosphorylation | TVPAAPSSPDTTSEP CCCCCCCCCCCCCCC | 26.24 | 30411139 | |
| 93 | Phosphorylation | AAPSSPDTTSEPKGP CCCCCCCCCCCCCCC | 35.29 | 28551015 | |
| 94 | Phosphorylation | APSSPDTTSEPKGPG CCCCCCCCCCCCCCC | 38.17 | 22673903 | |
| 95 | Phosphorylation | PSSPDTTSEPKGPGD CCCCCCCCCCCCCCC | 54.73 | 22673903 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CEND_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CEND_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CEND_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CEND_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
