CELA1_BOVIN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CELA1_BOVIN
• UniProt AC: Q28153
• Protein Name: Chymotrypsin-like elastase family member 1
• Gene Name: CELA1
• Organism: Bos taurus (Bovine).
• Sequence Length: 266
• Subcellular Localization: Secreted.
• Protein Description: Acts upon elastin..
• Protein Sequence: MLRLLVFTSLVLYGHSTQDFPETNARVVGGTAVSKNSWPSQISLQYKSGSSWYHTCGGTLIKQKWVMTAAHCVDSQMTFRVVLGDHNLSQNDGTEQYISVQKIVVHPSWNSNNVAAGYDIAVLRLAQSATLNSYVQLGVLPQSGTILANNTPCYITGWGRTKTNGQLAQTLQQAYLPSVDYATCSSSSYWGSTVKTTMVCAGGDGVRAGCQGDSGGPLHCLVNGQYAVHGVTSFVSSLGCNVSKKPTVFTRVSAYISWINNAIASN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
87	N-linked_Glycosylation	RVVLGDHNLSQNDGT EEEECCCCCCCCCCC	46.24	-
241	N-linked_Glycosylation	FVSSLGCNVSKKPTV HHHHCCCCCCCCCCE	39.02	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CELA1_BOVIN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CELA1_BOVIN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CELA1_BOVIN !!

Protein-Protein Interaction

Oops, there are no PPI records of CELA1_BOVIN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.