UniProt ID | CEAM8_HUMAN | |
---|---|---|
UniProt AC | P31997 | |
Protein Name | Carcinoembryonic antigen-related cell adhesion molecule 8 | |
Gene Name | CEACAM8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 349 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . Cell surface . |
|
Protein Description | Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. [PubMed: 8776764] | |
Protein Sequence | MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
100 | Phosphorylation | PAYSNRETIYPNASL CCCCCCCCCCCCCEE | 23.67 | 25072903 | |
102 | Phosphorylation | YSNRETIYPNASLLM CCCCCCCCCCCEEEE | 9.61 | 25072903 | |
104 | N-linked_Glycosylation | NRETIYPNASLLMRN CCCCCCCCCEEEECC | 25.78 | UniProtKB CARBOHYD | |
106 | Phosphorylation | ETIYPNASLLMRNVT CCCCCCCEEEECCCC | 28.77 | 25072903 | |
111 | N-linked_Glycosylation | NASLLMRNVTRNDTG CCEEEECCCCCCCCC | 26.08 | UniProtKB CARBOHYD | |
115 | N-linked_Glycosylation | LMRNVTRNDTGSYTL EECCCCCCCCCCEEE | 41.66 | UniProtKB CARBOHYD | |
120 | Phosphorylation | TRNDTGSYTLQVIKL CCCCCCCEEEEEEEE | 16.89 | - | |
126 | Methylation | SYTLQVIKLNLMSEE CEEEEEEEEECCCCE | 32.25 | - | |
152 | N-linked_Glycosylation | PKPSISSNNSNPVED CCCCCCCCCCCCCCC | 49.51 | UniProtKB CARBOHYD | |
173 | N-linked_Glycosylation | TCEPETQNTTYLWWV EECCCCCCEEEEEEE | 41.63 | UniProtKB CARBOHYD | |
197 | N-linked_Glycosylation | RLQLSNGNRTLTLLS CEEECCCCEEEEEEE | 37.70 | UniProtKB CARBOHYD | |
224 | N-linked_Glycosylation | IQNPASANFSDPVTL ECCCCCCCCCCCEEE | 34.16 | UniProtKB CARBOHYD | |
256 | N-linked_Glycosylation | YHAGVNLNLSCHAAS EECCEEEEEEEECCC | 25.38 | UniProtKB CARBOHYD | |
274 | N-linked_Glycosylation | SQYSWSVNGTFQQYT HHCEEEECCCHHHHE | 37.97 | UniProtKB CARBOHYD | |
288 | N-linked_Glycosylation | TQKLFIPNITTKNSG EEEEECCCCCCCCCC | 39.15 | 17623646 | |
288 | N-linked_Glycosylation | TQKLFIPNITTKNSG EEEEECCCCCCCCCC | 39.15 | 16740002 | |
296 | Phosphorylation | ITTKNSGSYACHTTN CCCCCCCCEEEEECC | 14.91 | - | |
309 | N-linked_Glycosylation | TNSATGRNRTTVRMI CCCCCCCCCCEEEEE | 47.17 | UniProtKB CARBOHYD | |
320 | GPI-anchor | VRMITVSDALVQGSS EEEEEEHHHHHCCCC | 39.32 | 2208113 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CEAM8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CEAM8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CEAM8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CEAM8_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
D02977 | Arcitumomab (USAN/INN); Cea-Scan (TN) | |||||
D06028 | Technetium Tc 99m arcitumomab (USP) | |||||
D06350 | Yttrium Y 90 labetuzumab (USAN); CES-Cide (TN) | |||||
D06351 | Yttrium Y 90 labetuzumab tetraxetan (USAN) | |||||
D08936 | Labetuzumab (INN/USAN) | |||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Identification of N-linked glycoproteins in human saliva byglycoprotein capture and mass spectrometry."; Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T.,Loo J.A.; J. Proteome Res. 5:1493-1503(2006). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-288, AND MASSSPECTROMETRY. |