| UniProt ID | CEAM7_HUMAN | |
|---|---|---|
| UniProt AC | Q14002 | |
| Protein Name | Carcinoembryonic antigen-related cell adhesion molecule 7 | |
| Gene Name | CEACAM7 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 265 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . Apical cell membrane . Localized to the apical glycocalyx surface. |
|
| Protein Description | ||
| Protein Sequence | MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 57 | N-linked_Glycosylation | EVLLVVHNESQNLYG EEEEEEEECCCCEEE | 38.72 | UniProtKB CARBOHYD | |
| 85 | N-linked_Glycosylation | RIIGYVKNISQENAP EEEEEEEECCCCCCC | 29.15 | UniProtKB CARBOHYD | |
| 105 | N-linked_Glycosylation | GRETIYPNGTLLIQN CCCEECCCCEEEEEE | 38.83 | UniProtKB CARBOHYD | |
| 112 | N-linked_Glycosylation | NGTLLIQNVTHNDAG CCEEEEEECCCCCCC | 33.39 | UniProtKB CARBOHYD | |
| 140 | Phosphorylation | EEVTRQFYVFSEPPK CCCCEEEEEECCCCC | 7.70 | 29116813 | |
| 149 | Phosphorylation | FSEPPKPSITSNNFN ECCCCCCCCCCCCCC | 44.62 | 29116813 | |
| 151 | Phosphorylation | EPPKPSITSNNFNPV CCCCCCCCCCCCCCC | 29.73 | 29116813 | |
| 174 | N-linked_Glycosylation | TCQPETQNTTYLWWV EECCCCCCCEEEEEE | 41.63 | UniProtKB CARBOHYD | |
| 183 | N-linked_Glycosylation | TYLWWVNNQSLLVSP EEEEEECCCEEEECC | 24.17 | UniProtKB CARBOHYD | |
| 198 | N-linked_Glycosylation | RLLLSTDNRTLVLLS EEEECCCCCEEEEEE | 38.64 | UniProtKB CARBOHYD | |
| 236 | Phosphorylation | PVTLNVRYESVQASS CEEEEEEEEEEECCC | 14.31 | 22817900 | |
| 242 | GPI-anchor | RYESVQASSPDLSAG EEEEEECCCCCCCHH | 25.88 | - | |
| 242 | Phosphorylation | RYESVQASSPDLSAG EEEEEECCCCCCCHH | 25.88 | - | |
| 243 | Phosphorylation | YESVQASSPDLSAGT EEEEECCCCCCCHHH | 26.00 | - | |
| 250 | Phosphorylation | SPDLSAGTAVSIMIG CCCCCHHHHHHHHHH | 24.49 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CEAM7_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CEAM7_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CEAM7_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CEAM7_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| D02977 | Arcitumomab (USAN/INN); Cea-Scan (TN) | |||||
| D06028 | Technetium Tc 99m arcitumomab (USP) | |||||
| D06350 | Yttrium Y 90 labetuzumab (USAN); CES-Cide (TN) | |||||
| D06351 | Yttrium Y 90 labetuzumab tetraxetan (USAN) | |||||
| D08936 | Labetuzumab (INN/USAN) | |||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
