UniProt ID | CE064_HUMAN | |
---|---|---|
UniProt AC | Q2M2E5 | |
Protein Name | Uncharacterized protein C5orf64 | |
Gene Name | C5orf64 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 130 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGPPPKDLTAEVYFPSIKSRSHLPAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKSTPIPILGVAM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Phosphorylation | HYSKLPRTAIETEFK CCCCCCCHHHHHHHH | 30.01 | 24719451 | |
42 | Phosphorylation | LPRTAIETEFKQNVG CCCHHHHHHHHHHCC | 40.38 | 24719451 | |
56 | Phosphorylation | GPPPKDLTAEVYFPS CCCCCCCCEEEECCC | 30.79 | 30206219 | |
60 | Phosphorylation | KDLTAEVYFPSIKSR CCCCEEEECCCCCCC | 10.98 | 30206219 | |
63 | Phosphorylation | TAEVYFPSIKSRSHL CEEEECCCCCCCCCC | 32.52 | 30206219 | |
66 | Phosphorylation | VYFPSIKSRSHLPAV EECCCCCCCCCCCCH | 37.03 | 30206219 | |
121 | Phosphorylation | ADCVLKSTPIPILGV HHHHHHCCCCCCCCC | 24.53 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CE064_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CE064_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CE064_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
H2AX_HUMAN | H2AFX | physical | 26186194 | |
H2AX_HUMAN | H2AFX | physical | 28514442 | |
OXLD1_HUMAN | OXLD1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...