CE064_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CE064_HUMAN
• UniProt AC: Q2M2E5
• Protein Name: Uncharacterized protein C5orf64
• Gene Name: C5orf64
• Organism: Homo sapiens (Human).
• Sequence Length: 130
• Subcellular Localization: Secreted .
• Protein Sequence: MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGPPPKDLTAEVYFPSIKSRSHLPAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKSTPIPILGVAM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	Phosphorylation	HYSKLPRTAIETEFK CCCCCCCHHHHHHHH	30.01	24719451
42	Phosphorylation	LPRTAIETEFKQNVG CCCHHHHHHHHHHCC	40.38	24719451
56	Phosphorylation	GPPPKDLTAEVYFPS CCCCCCCCEEEECCC	30.79	30206219
60	Phosphorylation	KDLTAEVYFPSIKSR CCCCEEEECCCCCCC	10.98	30206219
63	Phosphorylation	TAEVYFPSIKSRSHL CEEEECCCCCCCCCC	32.52	30206219
66	Phosphorylation	VYFPSIKSRSHLPAV EECCCCCCCCCCCCH	37.03	30206219
121	Phosphorylation	ADCVLKSTPIPILGV HHHHHHCCCCCCCCC	24.53	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CE064_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CE064_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CE064_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
H2AX_HUMAN	H2AFX	physical	26186194
H2AX_HUMAN	H2AFX	physical	28514442
OXLD1_HUMAN	OXLD1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.