| UniProt ID | CE034_HUMAN | |
|---|---|---|
| UniProt AC | Q96MH7 | |
| Protein Name | Uncharacterized protein C5orf34 | |
| Gene Name | C5orf34 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 638 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MAAELRMILYEDDSVQVQYVDGSTLQLSPCGTEFLFEKSPPVSAHPLEQPERIRQRTHFVISTYREQLQRALDFRNSSATCPFLSETIIPSERKKHIFIDITEVRWPSLDTDGTMIYMESGIVKITSLDGHAYLCLPRSQHEFTVHFLCKVSQKSDSSAVLSETNNKAPKDKLVEKTGKICIRGNLPGQRLKNKENEFHCQIMKSKETLKKMSCVNGTEGREELPSPGTKHTCVYTWVKQCWSVAACPEEWKYPLSLALHFHNKISNMSKIDAHITQSRFLTSDISEERGKVVSVLPRALSLSCPVPHLHRWNFCDSLLQRQSDEYSYPELVKMVWYKGVTYRLTHQNMNSIEIYSGDGSVFKSEGAYFGNYFTYYSIQEGSGKREEKTYSVNNLPPDRPGSPFTVGSLIKQATRILQHCVKMRLSLSHNYRICCWKMVPGINDSNILPLVLKESLIPSVGRFLAYSDDKVHAIFLDGITLTLNWNFSSPIEKRQVNQGLNLGWCKLTFPDGQEQLIQIEHPEPYERYVTTVTSWCRRLTQTSPREMPTHSSSSVLQENWSVASELEKIQKFNLLLENSGILNQISNKKNEQQSFDHYKPGSSETLLGEVNENRVSIALKKTSEILHDIDCLLSNSKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 36 | Ubiquitination | PCGTEFLFEKSPPVS CCCCEEEEECCCCCC | 15.68 | 22817900 | |
| 40 | Ubiquitination | EFLFEKSPPVSAHPL EEEEECCCCCCCCCC | 44.36 | 21963094 | |
| 53 | Ubiquitination | PLEQPERIRQRTHFV CCCCHHHHHHHCCCH | 4.14 | 21963094 | |
| 56 | Ubiquitination | QPERIRQRTHFVIST CHHHHHHHCCCHHHH | 21.96 | 22817900 | |
| 58 | Ubiquitination | ERIRQRTHFVISTYR HHHHHHCCCHHHHHH | 19.71 | 22817900 | |
| 91 | Phosphorylation | LSETIIPSERKKHIF CCCCCCCCCCCCEEE | 39.36 | 24719451 | |
| 150 | Ubiquitination | FTVHFLCKVSQKSDS EEEEEEEEECCCCCC | 47.25 | 22817900 | |
| 152 | Phosphorylation | VHFLCKVSQKSDSSA EEEEEEECCCCCCCC | 19.86 | 30622161 | |
| 154 | Ubiquitination | FLCKVSQKSDSSAVL EEEEECCCCCCCCCH | 49.04 | 21906983 | |
| 155 | Phosphorylation | LCKVSQKSDSSAVLS EEEECCCCCCCCCHH | 34.78 | 30622161 | |
| 156 | Ubiquitination | CKVSQKSDSSAVLSE EEECCCCCCCCCHHH | 54.36 | 21963094 | |
| 157 | Phosphorylation | KVSQKSDSSAVLSET EECCCCCCCCCHHHC | 27.56 | 30622161 | |
| 158 | Phosphorylation | VSQKSDSSAVLSETN ECCCCCCCCCHHHCC | 27.64 | 30622161 | |
| 162 | Phosphorylation | SDSSAVLSETNNKAP CCCCCCHHHCCCCCC | 35.46 | 30622161 | |
| 164 | Phosphorylation | SSAVLSETNNKAPKD CCCCHHHCCCCCCHH | 40.49 | 30622161 | |
| 167 | Ubiquitination | VLSETNNKAPKDKLV CHHHCCCCCCHHHHH | 69.04 | 21963094 | |
| 167 | Methylation | VLSETNNKAPKDKLV CHHHCCCCCCHHHHH | 69.04 | - | |
| 170 | Methylation | ETNNKAPKDKLVEKT HCCCCCCHHHHHHHC | 72.81 | - | |
| 170 | Ubiquitination | ETNNKAPKDKLVEKT HCCCCCCHHHHHHHC | 72.81 | 22817900 | |
| 172 | Ubiquitination | NNKAPKDKLVEKTGK CCCCCHHHHHHHCCC | 61.63 | 22817900 | |
| 177 | Ubiquitination | KDKLVEKTGKICIRG HHHHHHHCCCEEECC | 30.15 | 22817900 | |
| 179 | Ubiquitination | KLVEKTGKICIRGNL HHHHHCCCEEECCCC | 39.37 | 29967540 | |
| 192 | Ubiquitination | NLPGQRLKNKENEFH CCCCHHHCCCCCHHH | 69.07 | - | |
| 218 | Phosphorylation | KMSCVNGTEGREELP HHCCCCCCCCCCCCC | 30.02 | 28555341 | |
| 219 | Ubiquitination | MSCVNGTEGREELPS HCCCCCCCCCCCCCC | 58.62 | 21963094 | |
| 224 | Ubiquitination | GTEGREELPSPGTKH CCCCCCCCCCCCCCE | 4.33 | 22817900 | |
| 226 | Phosphorylation | EGREELPSPGTKHTC CCCCCCCCCCCCEEE | 48.89 | 28674419 | |
| 230 | Ubiquitination | ELPSPGTKHTCVYTW CCCCCCCCEEEEEEE | 42.71 | 29967540 | |
| 270 | Ubiquitination | NKISNMSKIDAHITQ HHHCCHHHHCHHHCH | 33.56 | 21963094 | |
| 286 | Phosphorylation | RFLTSDISEERGKVV HCCCCCCCHHHCCEE | 38.09 | - | |
| 291 | Ubiquitination | DISEERGKVVSVLPR CCCHHHCCEEEEHHH | 45.76 | 22817900 | |
| 297 | Ubiquitination | GKVVSVLPRALSLSC CCEEEEHHHHHHCCC | 19.83 | 21963094 | |
| 323 | Ubiquitination | DSLLQRQSDEYSYPE HHHHHHCCCCCCHHH | 34.30 | 21963094 | |
| 333 | Ubiquitination | YSYPELVKMVWYKGV CCHHHHHHHHHHCCC | 40.12 | 21963094 | |
| 338 | Ubiquitination | LVKMVWYKGVTYRLT HHHHHHHCCCEEEEE | 31.06 | 22817900 | |
| 339 | Ubiquitination | VKMVWYKGVTYRLTH HHHHHHCCCEEEEEC | 10.99 | 21987572 | |
| 360 | Phosphorylation | EIYSGDGSVFKSEGA EEEECCCCEEEEECC | 29.17 | 22210691 | |
| 392 | Ubiquitination | REEKTYSVNNLPPDR CEECEEECCCCCCCC | 3.76 | 21963094 | |
| 402 | Phosphorylation | LPPDRPGSPFTVGSL CCCCCCCCCCCHHHH | 21.37 | 28555341 | |
| 408 | Phosphorylation | GSPFTVGSLIKQATR CCCCCHHHHHHHHHH | 23.68 | 24719451 | |
| 411 | Ubiquitination | FTVGSLIKQATRILQ CCHHHHHHHHHHHHH | 38.89 | 21963094 | |
| 426 | Phosphorylation | HCVKMRLSLSHNYRI HHHHHHHHCCCCEEE | 19.91 | 28555341 | |
| 437 | Ubiquitination | NYRICCWKMVPGIND CEEEEEEEECCCCCC | 18.99 | 21963094 | |
| 445 | Phosphorylation | MVPGINDSNILPLVL ECCCCCCCCHHHHHH | 22.68 | - | |
| 453 | Ubiquitination | NILPLVLKESLIPSV CHHHHHHHHHHCCCH | 37.46 | 21987572 | |
| 454 | Ubiquitination | ILPLVLKESLIPSVG HHHHHHHHHHCCCHH | 46.76 | 22817900 | |
| 455 | O-linked_Glycosylation | LPLVLKESLIPSVGR HHHHHHHHHCCCHHH | 29.97 | 30379171 | |
| 457 | Ubiquitination | LVLKESLIPSVGRFL HHHHHHHCCCHHHHH | 3.13 | 21963094 | |
| 474 | Ubiquitination | SDDKVHAIFLDGITL CCCCEEEEEECCEEE | 1.81 | 21963094 | |
| 475 | Ubiquitination | DDKVHAIFLDGITLT CCCEEEEEECCEEEE | 5.44 | 21963094 | |
| 485 | Ubiquitination | GITLTLNWNFSSPIE CEEEEEECCCCCCCC | 15.45 | 21963094 | |
| 506 | Ubiquitination | GLNLGWCKLTFPDGQ CCCCEEEEEECCCCC | 44.01 | 21963094 | |
| 528 | Phosphorylation | HPEPYERYVTTVTSW CCCCCHHHHHHHHHH | 7.10 | 22210691 | |
| 530 | Phosphorylation | EPYERYVTTVTSWCR CCCHHHHHHHHHHHH | 13.45 | 22210691 | |
| 531 | Phosphorylation | PYERYVTTVTSWCRR CCHHHHHHHHHHHHH | 16.25 | 22210691 | |
| 540 | Phosphorylation | TSWCRRLTQTSPREM HHHHHHHCCCCCCCC | 28.17 | 24425749 | |
| 542 | Phosphorylation | WCRRLTQTSPREMPT HHHHHCCCCCCCCCC | 35.15 | 24425749 | |
| 568 | Ubiquitination | SVASELEKIQKFNLL HHHHHHHHHHHHHHH | 64.16 | 22817900 | |
| 571 | Ubiquitination | SELEKIQKFNLLLEN HHHHHHHHHHHHHHC | 39.43 | 21963094 | |
| 588 | Ubiquitination | ILNQISNKKNEQQSF HHHHHCCCCCCCCCC | 50.62 | 21906983 | |
| 589 | Ubiquitination | LNQISNKKNEQQSFD HHHHCCCCCCCCCCC | 70.71 | 21963094 | |
| 598 | Phosphorylation | EQQSFDHYKPGSSET CCCCCCCCCCCCCHH | 22.26 | 28555341 | |
| 599 | Ubiquitination | QQSFDHYKPGSSETL CCCCCCCCCCCCHHE | 39.21 | 21963094 | |
| 603 | Phosphorylation | DHYKPGSSETLLGEV CCCCCCCCHHEEEEE | 40.28 | 28555341 | |
| 616 | Phosphorylation | EVNENRVSIALKKTS EECCCCEEEEEEHHH | 10.02 | 30576142 | |
| 621 | Ubiquitination | RVSIALKKTSEILHD CEEEEEEHHHHHHHH | 59.12 | 29967540 | |
| 637 | Ubiquitination | DCLLSNSKK------ HHHHHCCCC------ | 67.75 | 29967540 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CE034_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CE034_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CE034_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CE034_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...