dbPTM

CDS2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CDS2_MOUSE
UniProt AC	Q99L43
Protein Name	Phosphatidate cytidylyltransferase 2
Gene Name	Cds2
Organism	Mus musculus (Mouse).
Sequence Length	444
Subcellular Localization	Mitochondrion inner membrane Multi-pass membrane protein Matrix side .
Protein Description	Provides CDP-diacylglycerol, an important precursor for the synthesis of phosphatidylinositol, phosphatidylglycerol, and cardiolipin..
Protein Sequence	MTELRQRVVREDAPPEDKESESEAKLDGETASDSESRAETAPLPTSVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSAIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILTSALEDE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	APPEDKESESEAKLD CCCCCCCCCCHHCCC	52.76	25521595
22	Phosphorylation	PEDKESESEAKLDGE CCCCCCCCHHCCCCC	52.73	25521595
30	Phosphorylation	EAKLDGETASDSESR HHCCCCCCCCCCCCH	36.67	25521595
32	Phosphorylation	KLDGETASDSESRAE CCCCCCCCCCCCHHC	49.44	27087446
34	Phosphorylation	DGETASDSESRAETA CCCCCCCCCCHHCCC	34.67	25521595
36	Phosphorylation	ETASDSESRAETAPL CCCCCCCCHHCCCCC	40.52	25521595
40	Phosphorylation	DSESRAETAPLPTSV CCCCHHCCCCCCCCC	32.37	25521595
45	Phosphorylation	AETAPLPTSVDDTPE HCCCCCCCCCCCCHH	49.41	26239621
46	Phosphorylation	ETAPLPTSVDDTPEV CCCCCCCCCCCCHHH	22.93	25521595
50	Phosphorylation	LPTSVDDTPEVLNRA CCCCCCCCHHHHHHH	19.51	25521595
59	Phosphorylation	EVLNRALSNLSSRWK HHHHHHHHCHHHHHH	34.44	22817900
62	Phosphorylation	NRALSNLSSRWKNWW HHHHHCHHHHHHHHH	23.31	22324799
63	Phosphorylation	RALSNLSSRWKNWWV HHHHCHHHHHHHHHH	45.38	22324799
438	Phosphorylation	LTDKGILTSALEDE- CCCCCCHHHHHCCC-	15.27	29899451
439	Phosphorylation	TDKGILTSALEDE-- CCCCCHHHHHCCC--	27.66	29899451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CDS2_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CDS2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CDS2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CDS2_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CDS2_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Specific phosphopeptide enrichment with immobilized titanium ionaffinity chromatography adsorbent for phosphoproteome analysis."; Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.; J. Proteome Res. 7:3957-3967(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-32, AND MASSSPECTROMETRY.	18630941 [Abstract]
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20; THR-30; SER-32 ANDSER-46, AND MASS SPECTROMETRY.	17242355 [Abstract]
"Mitochondrial phosphoproteome revealed by an improved IMAC method andMS/MS/MS."; Lee J., Xu Y., Chen Y., Sprung R., Kim S.C., Xie S., Zhao Y.; Mol. Cell. Proteomics 6:669-676(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-32, AND MASSSPECTROMETRY.	17208939 [Abstract]
"Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations."; Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.; Mol. Cell. Proteomics 6:283-293(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-32, AND MASSSPECTROMETRY.	17114649 [Abstract]