CDRT4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CDRT4_HUMAN
• UniProt AC: Q8N9R6
• Protein Name: CMT1A duplicated region transcript 4 protein
• Gene Name: CDRT4
• Organism: Homo sapiens (Human).
• Sequence Length: 151
• Protein Sequence: MDARRMKKEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSSGKAVFRDTLSESTLSMWGAYSVLAMAPTMIPEPTHLHADSRDCPTENYNKIIFARKPMMRMLPTVRY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
46	2-Hydroxyisobutyrylation	VKRLIEKSKTRELEC HHHHHHHHHHHHHHH	26.86	-
70	Phosphorylation	ASRQNKPSSVIQPKR HHHCCCCCCCCCCCC	38.56	29978859
71	Phosphorylation	SRQNKPSSVIQPKRR HHCCCCCCCCCCCCC	31.59	29978859
94	Phosphorylation	AVFRDTLSESTLSMW HHHHHCCCHHHHHHH	31.43	22210691
118	Phosphorylation	PTMIPEPTHLHADSR CCCCCCCCCCCCCCC	35.09	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CDRT4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CDRT4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CDRT4_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CDRT4_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.