UniProt ID | CDRT4_HUMAN | |
---|---|---|
UniProt AC | Q8N9R6 | |
Protein Name | CMT1A duplicated region transcript 4 protein | |
Gene Name | CDRT4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 151 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDARRMKKEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSSGKAVFRDTLSESTLSMWGAYSVLAMAPTMIPEPTHLHADSRDCPTENYNKIIFARKPMMRMLPTVRY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | 2-Hydroxyisobutyrylation | VKRLIEKSKTRELEC HHHHHHHHHHHHHHH | 26.86 | - | |
70 | Phosphorylation | ASRQNKPSSVIQPKR HHHCCCCCCCCCCCC | 38.56 | 29978859 | |
71 | Phosphorylation | SRQNKPSSVIQPKRR HHCCCCCCCCCCCCC | 31.59 | 29978859 | |
94 | Phosphorylation | AVFRDTLSESTLSMW HHHHHCCCHHHHHHH | 31.43 | 22210691 | |
118 | Phosphorylation | PTMIPEPTHLHADSR CCCCCCCCCCCCCCC | 35.09 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDRT4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDRT4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDRT4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CDRT4_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...